KEGG   Gallus gallus (chicken): 429828Help
Entry
429828            CDS       T01006                                 

Gene name
CYP21A2, CYP21
Definition
cytochrome P450, family 21, subfamily A, polypeptide 2 (EC:1.14.99.10)
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    429828 (CYP21A2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     429828 (CYP21A2)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP21 family
   429828 (CYP21A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
16
AA seq 478 aa AA seqDB search
MAVTILLLLLLLALIWGGSARRGGAPWGGALHLLHPGGPRHLHILARTYGDPLCLRLGGC
EVVVLSSAAAIREALARRWGDFVGRPHSYLASLVSRGGQDLALGDASPEWRRQRGATRGA
LARAVRHLEPLLELQGWALCQELSSYGAAPVDLFEAFTFHTCSTICRLAFGDLMPPEAEV
RSFTRCVVELLEVWGRASVRALDVLPSLRVLPNAGLRELLRLVERRDAFVESQIRWHQVG
NVGTQGCASPPRDTVLGALLGGDPTVPMGPLGGDRLHMALVDLFIGGTETTAVALLWAVA
FLLHHPQVQDQVRAELRQVLGPRGTPKPGDMGRLPLLRATVTETLRLRPPAPLALPHCAR
RHSSIAGIPVPAGSIVIPNLFAAHHDPKIWDRPDEFLPERFLQPGAPWRALLPFGCGARS
CVGEALARAELFVFLGHILQRFRLEPPSDGALPHLGVTAGTVLRCAPFRVRLTPCPPP
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgacgatacttctgctgctacttctcctggctctgatctggggggggtcagcc
aggcgggggggagcaccgtgggggggggccctgcacctcctgcacccaggggggccacgg
cacctccacatccttgcccggacctacggggaccccttatgcctgcgcttgggggggtgt
gaggtggtggtgctgagctctgcagcagccatccgtgaggcactggcacggcgctggggg
gacttcgtgggacgcccccacagttacctggcgtccctggtgtcgcggggggggcaggac
ctggcgctgggggatgcatccccagagtggcgacggcagcggggggcaacgcggggagca
ctggcgcgagctgtgaggcacctggagcccctcctggagctgcagggctgggcgctgtgc
caggagttgagctcttatggggctgccccagtggacctctttgaggcgttcacgttccac
acctgcagcaccatctgccgccttgccttcggggacctgatgccccccgaggcggaggtg
cgctccttcacgcgctgtgtggtggaactgctggaggtgtggggccgggccagtgtgcgg
gcactggatgtgctgccttcgctaagggtgctgcccaacgcagggctgcgggagctgctg
cgcctggtggagcgccgcgatgcctttgtggagtcccagatccgatggcaccaggtgggg
aacgtggggacacagggctgtgcgtctccccccagggacacagtgttgggagcactgctg
gggggggaccccactgtccctatggggccgctggggggggaccgcctgcacatggccctc
gtggatctcttcatcggtggcaccgaaacgacggcagtggctctgctatgggctgtggcc
ttcctgctgcaccacccccaggtgcaggaccaggtacgtgcagagctgcgccaggtgctg
ggccccagggggaccccaaagccaggggatatggggcgactgccactgctccgtgccact
gtcaccgagaccctccgcctgcgaccccctgcgcccctcgcgctgccccactgtgcccgg
cgccactccagcattgcgggaatcccagtgcctgcgggatccatcgttatcccaaacctc
tttgctgcgcaccacgaccccaagatttgggaccgtcctgatgagttcctgcccgagcgg
ttcctgcagccgggggctccatggcgagcgctgctgccctttggttgtggggcacgctcg
tgtgtgggggaggcgctggctcgggcagagctctttgtgtttttggggcacatcctacag
cgattccgcctggagccaccgtctgatggggctctgccccacttaggggtcactgctggc
accgtgctgcgctgtgccccgttccgcgtgcgcctcacgccctgcccacccccatag

DBGET integrated database retrieval system