KEGG   Gallus gallus (chicken): 429878Help
Entry
429878            CDS       T01006                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
Z
AA seq 736 aa AA seqDB search
MARGSLGGADMEREKLPRRPGSALRWERPEESEAGEAAGPWPGCGRMRPSSYRALRSAVS
TLARIDDFYCEKIGTGFFSEVFKVRHRQSGQIMVLKMNKLTSNRGNMLREVQLMNRLSHP
NILRFMGVCVHQGQLHALTEYINGGNLEQLLDSPVPLSWSTRVKLALDIARGLRYLHSKG
IFHRDLTSKNCLVRCEANGYTAVVGDFGLAEKIPTYSEGSEKEPLAVVGSPYWMAPEVLR
GEIYNEKADVFAYGIILCETIARVPADPDYLPRTEDFGLDITAFRTMVGNDCPAAFLQLA
FHCCSMEPTSRPSFLEITQCLEGVLQHQLGTEGAGTTLFCTGDSVPAPSTVSAFSGTWAS
QECGLPIILGERICGTEPHCPLPASSPHSTGDSLLCPHPGVAVRAAGRAEQSPLRELGTQ
HLQPDQHLSRSHSDVFPPKSPISEPCSEARTKETPPRVNPFSQREDLKGGKIKLFDIPSK
SVISLTFDLPPPTPLQLATPVTPEPAVEVQCDFSAPTTPSRKCHSLPASPELPHRGGLAL
GVRSPSQPPAPKQSRWDSGEPRIPSSPGVEERRDCAPRHPEPPLPQLCAPPSTSGTFIRT
LASGSNPWQPEPLNRQLLNNHHPAAVSKPLSWGSGLEHGFSELSIPCTAAALERTEHAAM
LPGHGSSMVLEQDEVLPCPSCCLGPFSFTSVCHRPAPSPPRYQNLNCEAKSLLCHDRLQK
AQGSAEPSLKLPEAQS
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggggtcgctcggcggggccgacatggagcgggagaagctgccgcggaggccg
ggctcggcgctgcgatgggagcggcccgaggagagcgaggcgggggaggcggcggggccg
tggccgggctgcgggaggatgcggccctcctcgtaccgcgcgctgcgcagcgccgtctcc
accctggcgcgcatcgacgatttctactgcgagaagatcggcaccggcttcttctccgag
gtgttcaaggtgcggcaccgccaatccgggcagatcatggtgctgaagatgaacaagctg
accagcaaccggggcaacatgctgcgggaggtgcagctgatgaaccgcctctcgcaccct
aacatcctcaggttcatgggggtgtgcgtgcaccaggggcagctgcacgcgctgacggag
tacatcaatggtggaaacctggagcagctgctggacagccctgtgcccctctcctggtcc
acgcgtgtcaagctggcactcgacatcgcccgtggcctgcgctacctgcactccaagggc
atcttccaccgtgacctcacctccaagaactgcctggtgcgctgtgaggccaatggctat
acggctgtggtgggcgacttcggcttggcagagaagatccccacctacagcgagggcagc
gagaaggagccgctggccgtggtgggctctccctactggatggcacccgaggttctgcgt
ggggagatctacaatgagaaggctgatgtgttcgcctatggcattatcctgtgcgagacc
attgctcgtgtccccgctgaccctgactacctgccccgcaccgaggatttcggcctggac
atcaccgctttccgtaccatggttggaaacgactgcccagcagccttcctccagctggcg
ttccactgctgcagcatggagcccacttctcgcccctccttcctggaaatcacgcagtgc
ctggagggcgtcctgcagcaccagctgggcactgagggtgccgggaccaccctcttctgc
accggggacagcgtgcccgcacccagcacagtgtccgcattcagtggtacgtgggcgtcc
caggagtgtgggttgcccatcattctgggggagaggatctgtgggacagagccccattgc
cctctgcccgcatcgtccccacattccactggtgactccctgctgtgcccccacccagga
gtggccgtgagggcggctggccgcgctgagcagtccccgctgcgcgagctggggacgcag
cacctgcagccggaccagcacctgtcccgcagccactctgacgtcttcccccccaaatca
cccatctcggagccctgcagtgaggccaggaccaaggagacgccaccccgcgtcaacccc
ttctcccagcgtgaggacctgaaggggggcaagatcaagctcttcgacatccccagcaag
tcggtcatctcgctcacatttgacctgccccctccaaccccactgcagcttgccaccccc
gtcactcctgagccagccgtggaggtgcagtgtgacttctcagcacccaccaccccgtcc
cgcaagtgccactcgctgcctgcctcccctgagctgccccaccgggggggcctggcgctg
ggcgtgaggtccccctcccagccccctgccccgaagcagagccgctgggacagcggagag
ccaagaatcccatccagccctggggtggaggagcggagagactgcgctccccgccaccct
gagccgccgctgccgcagctctgcgctccgccatccactagtggcaccttcatccgcaca
ttggcctcgggaagcaatccgtggcagccggagccgctcaacaggcagctcctcaacaat
caccaccccgcagcggtcagcaagccgctgtcctggggcagtgggctggagcatggcttc
tccgagctcagcatcccctgcacggcagcggcgctggagcggacggagcacgcagccatg
ctgcctgggcacggctccagcatggtgctggagcaggacgaggtgctgccctgccctagc
tgctgcttgggccccttcagcttcacctctgtttgtcaccggccggcacccagcccgccc
cgctaccagaacctcaactgcgaggccaagagccttctctgccacgaccgcctccagaaa
gcccaggggtcagcagagcccagcctgaagctgcccgaggcgcagtcctag

DBGET integrated database retrieval system