KEGG   Gallus gallus (chicken): 430150Help
Entry
430150            CDS       T01006                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    430150 (CACNA2D2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    430150 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    430150 (CACNA2D2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   430150 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
12
AA seq 1489 aa AA seqDB search
MQYWARRLEQEIDGVMRIFGGVQQLRGIYNENRNLFEVKENVPRKLVEKVAGDIESLLAK
KVRALKRLANAAEKFQKAHHWQDNIREEDIEYYDSKADTEFVSAVSTDDPDGEEIEREKS
NSLKLEFTDDANFKTKVNYSYAAVQIPTDIYKGSTVILNELNWTQALEDVFIENRKEDPS
LLWQVFGSATGVTRYYPATPWRAPNKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSG
LTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAKPVSCFKHLVQANIRNKKVFKEDVQGMV
AKGTTDYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNKTVRAP
HCLPMGMGWGWQVLSTMGTGSRYNMCPDSHAVPQVRVFTFSVGQHNYDVTPLQWMACANK
GEQGLVLGTHGWQPPPGMWGHLARGGWQWCWQHGQAAGQMLQNAGSLPASLFPFQGYYFE
IPSIGAIRINTQEYLDVLGRPMVLAGNRAKQVQWTNVYQDALGLGLVVTGTLPVFNLTED
NSDRKNQLILGVMGIDVALNDIKKLTPRYNLGANGYVFAIDLNGYVLLHPNLQPQIINFR
EPVTLDFLDAELEDENKEEIRRSMIDGNDGQRFIKTLIKSLDEQYIDEVFRTYTWAPIKS
TNYSLGLVLPPYSTYYIQANLSDQILQVKLPNIKMKDFEYLLPNSFESEGHVFIAPREYC
KDLDLSDNNTEFLENFIALMEKVTPDSKQCDNFLLHNLILDTGITQQLVERVWKDQDLNT
YSLLAVFAATDGGITRVFPNKAADDWEEEPEPFNASFYRRSLDNKGYIFKPPYRDGECLQ
STVGVPWLSPCAPFMPPLSSTDGYRGLDLENNTIGILVSTAVELSIGGKTLKPAVVGVKL
DLEAWAEKFKVLASNRTDRDQLGSRRCDPSSSCEMDCEANNKDLICVLIDDGGFLVLSNQ
EDHWYQVGKFFSEVDANLMSALYNNSFYARKESYDFQSVCAPEAQSNTGAAPRGVFVVSA
HQPVRVPAWLMSPTTSPPLFPQPTVADLLSLAWWTSAAAWSLFQQFLYSLTYSSWFQTED
VMADGMEARETSCIMKQTQYYFSTVNATYNAIIDCGNCSRWVCPLHPGGVPVGLRGGDGD
TRPTPPVRPPGCSMRRGWPTPTCSSWWLTSPCAASASPSSCCRPRSGLPRETRTSVSWWT
GPATGKAPTSASTTMQQKIPQTAAEGRPSPPPSGSCSPCSCCSSTPAPAGTRCPRPPAFN
PRPPPSCSLSLHLHLFPRPGGMGATPPLPPGLGAALPTAASKEELGCGQGPPNRDGVRPP
PAAWTPKAPSGCPPPLQPPPSPFTYFFSLKILNQIFLHLVQPGERRCVSSVTKTRGIKGE
IITHKKKNKQKTKREEELSCLSCSVCLWGCRPRGAGGQQRQRPCGAGLSAGSQASPSPGP
DQAHGPPPQLIRSHSCVSGTDIGVKRREKKKKKDKNCIFFFSFPFCRSL
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgcagtactgggccagaaggctggagcaggagattgatggcgtgatgaggatatttggt
ggcgtccagcagctcagagggatctacaatgagaacagaaacctgtttgaagtcaaggag
aacgtgcccagaaaattagtggagaaggttgcaggggacatcgagagcctgctggccaag
aaagtccgtgctttaaagaggctggccaacgcagcagagaagttccagaaggcccaccac
tggcaggacaacatccgggaggaggacatcgagtactacgactccaaggcggacacggaa
ttcgtgagtgctgtgagtactgatgatcccgatggggaagaaatcgagcgggagaaatcc
aactcccttaagctggagttcaccgacgatgccaacttcaagaccaaggttaactactca
tatgctgccgtgcagatccccactgacatctacaaaggctccaccgtgatcctcaacgag
ctgaactggacgcaggcgctggaggacgtcttcattgagaaccgcaaggaagacccctcc
ctgctctggcaggtcttcggcagcgccaccggcgtcacccgctactaccctgccacccca
tggagagcacccaataagatcgacctgtatgacgtgcgcagacggccctggtacatccag
ggtgcttcgtccccaaaggacatggtcatcatcgtggatgtgagcggcagtgtgagcggc
ctcaccctcaagctgatgaagacctcggtctgtgagatgctggacacgctctcggatgat
gactacgtcaacgtggcctcgttcaacgagaaggcaaagccggtgtcatgcttcaagcac
ctggtgcaggccaacatccgcaacaagaaggtcttcaaggaggatgtgcagggcatggtg
gccaagggcacgactgactacaaggctggctttgagtatgccttcgaccagctgcagaat
tccaacatcacacgtgccaactgcaacaagatgatcatgatgttcacagacggtggtgag
gaccgggtgcaggacgtctttgagaagtacaactggcccaataagacggtgcgtgctccc
cactgcctgccaatggggatgggctggggctggcaggttctgagcaccatggggacgggg
tcacggtataacatgtgccctgacagccatgctgtgccacaggtgcgtgtctttaccttc
tccgtggggcagcacaactatgacgtgaccccactgcagtggatggcatgcgccaacaaa
ggtgagcaggggctggtgctgggcacgcacgggtggcagccccccccgggcatgtggggt
cacctggcacgtgggggctggcagtggtgctggcagcacgggcaggcagcgggacagatg
ctgcagaatgctggctctctacctgcatctctctttcctttccaaggttactacttcgaa
atcccctctatcggcgccatccgcatcaacacacaggagtacctggatgtgctgggcagg
cccatggtgctggctgggaaccgtgccaagcaggtgcagtggaccaacgtctaccaggat
gcgctggggctggggctggtggtgacaggcacgctgcccgtgttcaacctgacagaggac
aacagtgacaggaagaaccagctcatcctgggtgtgatggggatcgacgtggcgctgaac
gacatcaagaagctgacaccacgatacaatctgggcgccaatggctacgtcttcgccatt
gacttgaatggctacgtgctgctgcaccccaacctgcagccccagatcatcaatttccgt
gagccggtgacgctggacttcctggacgccgagctggaggacgagaacaaggaggagatc
cggagaagcatgattgatgggaacgatgggcagaggttcatcaagacacttatcaagtcg
ctggacgagcaatacatcgacgaggtgttcaggacctacacgtgggctcccatcaaaagc
accaactacagcctggggctggtcctgcccccctacagcacctactacatccaggccaac
ctcagtgaccagatcctgcaagtgaagttaccaaacatcaaaatgaaggattttgaatac
ctgctgcccaacagctttgagtcggagggacatgtgttcattgctcccagagagtattgc
aaagacctcgacttgtcagataacaacaccgagttcctggagaactttattgccctcatg
gaaaaggtgaccccagactccaagcagtgtgacaatttcctcctgcacaacctaatcctg
gacacgggcatcacacagcagctggtggagcgcgtctggaaggaccaggacctcaacacg
tacagtctcctggctgtcttcgctgccacagatgggggcatcacccgtgtcttcccaaac
aaagccgcagatgactgggaggaggaaccggagcccttcaacgccagcttctaccgcagg
agcctggataacaagggctacatattcaaaccgccctaccgggatggtgagtgcctgcag
agcactgtgggtgtgccctggctgtccccgtgtgcccccttcatgccacccctgtcctcc
acagatggctaccgggggctggatctggagaacaacaccattgggatcctggtgagcacc
gccgtggagctcagcatagggggcaagacgctaaagccagcagtggtcggggtgaagctg
gacctggaggcctgggcagagaagttcaaggttctggcaagcaaccggacagaccgcgac
cagctgggctcccgccggtgtgacccctcgagtagctgtgagatggactgcgaggccaac
aacaaggacctcatctgcgtcctcattgatgacggaggcttcctggtgctctccaaccag
gaggatcactggtaccaggtgggcaagttcttcagtgaggtggacgccaacctgatgtct
gccctctacaacaactccttctacgcccgcaaagagtcctacgacttccagtccgtctgt
gccccggaggcccagagcaacacgggtgctgcaccacgtggtgtctttgtggtgagtgcc
caccaacccgtgcgtgtgccagcgtggctcatgagtcccaccacctcaccacccctcttc
ccgcagcccaccgtggccgacctgctgagcctggcctggtggacctcggcggcagcctgg
tccctcttccagcagttcctctacagcctcacctacagcagctggttccagacagaggac
gtcatggcagacggcatggaggcgagggagacgagctgcatcatgaagcagacgcagtac
tacttcagcaccgtcaacgccacttacaacgccatcatcgactgcgggaactgctcgagg
tgggtctgtcccctgcatcccggcggtgtccccgttgggcttcgggggggggatggtgac
acaaggccaacgccacccgtgcgtcctccaggctgttccatgcgcagaggctggccaaca
ccaacctgctcttcgtggtggctgacaagcccctgtgcagccagtgcgagtccgtcaagc
tgctgcaggccgaggtcagggctcccccgagagacccgaaccagtgtgagctggtggaca
ggccccgctaccggaaaggcccccacatctgcttcgactacaatgcaacagaagatacct
cagactgcggccgaggggcgtccttcaccccctccctcggggtcctgctctccctgcagt
tgctgctcctctacgccagcaccagccggcacccgctgcccccggccgcctgcctttaac
ccacgcccgccgccctcctgttctctcagcctccatctccatctgtttccaaggcccggt
gggatgggagcaacccccccactgccccccggcctcggggccgcgctccccacggccgca
tccaaagaagagctggggtgtgggcaggggccccccaaccgggacggcgtccggcccccc
ccggccgcttggactccgaaagccccctctggctgccccccaccgctgcagcccccccca
tcccccttcacctatttttttagcctcaagattttaaaccagatctttctacatctagtt
cagcctggagaacgacggtgcgtgtcgtcggtgacaaagacacgtgggataaaaggggaa
ataattacacacaaaaaaaaaaacaaacaaaaaacaaaaagggaagaggagttgtcctgc
ctgtcctgctcggtgtgcttatggggatgccgcccccggggtgcaggaggacagcagagg
cagcgtccctgcggcgcggggctcagtgcggggagccaggcgtcaccttcaccgggaccg
gaccaagcccatggtcccccccctcagctcatccgctctcattcatgtgtctcgggcaca
gatattggggtgaaaaggagagaaaaaaaaaaaaaaaaagacaaaaattgtatttttttt
ttttcttttccgttctgcagatcactgtga

DBGET integrated database retrieval system