KEGG   Gallus gallus (chicken): 430227Help
Entry
430227            CDS       T01006                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     430227 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 117 aa AA seqDB search
MARARYQLRGASPFRFGSFASCSFSRERAESFGQDTFLSIRSCFGVPIHAFSLYTEEEEV
LIPGHEIFWVFPDSGTHRFVLRSSNRTCSHFNCAFLGHEKSPECRGSTAIPGHRDEL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcccgctaccagctgcggggtgccagccccttcaggttcggctccttcgcc
tcctgctccttcagcagggagcgggccgagagcttcgggcaggacacgttcctcagcatc
cgcagctgcttcggggtccccatccacgccttctccctctacacggaggaggaggaggtg
ctgatccccggccatgagatcttctgggtcttcccggacagcgggactcaccgcttcgtg
ctgcggagctccaacaggacctgcagccacttcaactgcgccttcctgggccatgagaag
agccccgagtgcaggggcagcacagccattcccgggcacagagacgagctgtga

DBGET integrated database retrieval system