KEGG   Gallus gallus (chicken): 430370Help
Entry
430370            CDS       T01006                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:gga01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gga00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gga00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gga00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gga00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:gga00524]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
22
AA seq 501 aa AA seqDB search
MLDHRSRMESWRQEKVEQILSEFRLKEEDLRKVMHRMQKEMDRGLKLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLRLVDENLLFSGQACEKLKTRGAFETRFVSQTVPHGGPLCHHPTAAVSDRPLLR
PLCHHPMVTFYSCPVLGFPTSLLHVGHQDPQPRLPTPASYIRVSFAITPAHSNSCPKLGP
SPSRHPTSALCSCLRWSPLSYWPGLESPIPLPHFGTLFPLSPCQPSRTVPMEVPCAITPM
TTLYDCPTLGFPAPSPHTSPL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccacaggagcaggatggagagctggcggcaggagaaggtggagcagatcctg
tccgagttccgtctgaaggaggaggacctgcggaaggtgatgcaccgcatgcagaaggag
atggaccgcgggctgaagctggagacgcacgaggaggcgtcggtgaaaatgctgcccacc
tacgtgcgctccacccccgaggggtcggaggtcggggatttcctctcgctggatctgggc
ggcaccaacttccgcgtgatgctggtgaaggtgggtgagggcgaggaggggcagtggaag
gtgaagacgaagcaccagatgtactccatccccgaggacgccatgacggggacggccgag
atgctcttcgactacatctcggagtgcatctccgacttcctggacaagcaccagatgaag
cacaaaaagctgcccctgggcttcaccttctccttccccgtgcggcacgaggacatcgac
aagggcatcctgctgaactggaccaagggcttcaaggcctcgggagcagaggggaacaac
gtggtggggctgctgcgggacgccataaaacggcgcggggactttgagatggacgtggtg
gccatggtgaacgacaccgtcgccaccatgatctcctgctactacgaggaccaccgctgc
gaggtcggcatgatcgtggggacgggctgcaacgcctgttacatggaggagatgcacaac
gtggagctggtggagggcgacgagggccgcatgtgtgtgaacacggagtggggcgcattt
ggggcgtcgggggagctggacgagttcctgctggagtacgaccgcgtggtggacgagacc
tcgcttaaccccggtcagcagctctacgagaagatcatcgggggcaaatacatgggggag
atcgtgcggctggtgctgctgcggctggtggatgagaacctgctgttcagcgggcaggcc
tgcgagaagctcaagacacgcggggccttcgagacgcgcttcgtgtcacagactgtccca
catgggggtcccctgtgccatcaccctacagcagctgtctctgatcgtcccttattgagg
cccctgtgccatcatcccatggtaaccttctacagctgcccagtattggggttccctacc
tcgttgcttcatgttgggcaccaggatccccagccccgtctccccacaccagcgtcctac
atcagggtctcctttgccattaccccagctcactctaatagctgtcccaaattgggaccc
tccccatctcgtcaccccacatcagccctctgtagctgcctacgttggagtcccctatcc
tactggcctgggttggagtcccctatcccactaccccactttgggaccctctttcctctt
agcccatgccagccctccagaactgtccccatggaggttccctgtgccatcacccccatg
acaacgctctacgactgccccacgttggggttccctgccccatcaccccacaccagccct
ctgtag

DBGET integrated database retrieval system