KEGG   Gallus gallus (chicken): 430370Help
Entry
430370            CDS       T01006                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00052  Galactose metabolism
gga00500  Starch and sucrose metabolism
gga00520  Amino sugar and nucleotide sugar metabolism
gga00524  Neomycin, kanamycin and gentamicin biosynthesis
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga04910  Insulin signaling pathway
Module
gga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gga_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    430370 (GCK)
   00052 Galactose metabolism
    430370 (GCK)
   00500 Starch and sucrose metabolism
    430370 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    430370 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    430370 (GCK)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    430370 (GCK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     430370 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 430370
NCBI-ProteinID: XP_015157917
CGNC: 53919
Ensembl: ENSGALG00000027313 ENSGALG00000032150
Position
22
AA seq 558 aa AA seqDB search
MGQPHPTEWAPYGAAPRCAKTLPSHNPTASPRRGAGAVLWGQRRGAILGGYAGWAPCGAP
PGAVGPTAITLSPLSRSCGRPSPWDRWRAGGGDQDTEWSRMESWRQEKVEQILSEFRLKE
EDLRKVMHRMQKEMDRGLKLETHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVM
LVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLG
FTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTV
ATMISCYYEDHRCEVGMIVGTGCNACYMEEMHNVELVEGDEGRMCVNTEWGAFGASGELD
EFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGEIVRLVLLRLVDENLLFSGQACEKLKTR
GAFETRFVSQVESDSGDRKQIYNILTAFGLLPSGSDCDIVRMVCESVSTRAAQMCSAGLA
GVINRMRESRSQETLKITVGVDGSVYKLHPSFKDRFHATVRQLTPGCDITFIQSEEGSGR
GAALISAVACKMACMMGQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcctcaccccacagaatgggccccctatggggcagccccccgatgcgccaaa
accctcccctcacacaaccccacagcttcaccccgccgtggggcaggcgccgtgctatgg
ggccagcgccgtggggccatcctggggggctatgccgggtgggccccatgtggggctccc
cccggcgctgtggggccgacggccatcacgctgtcacctttgtcacggagctgcggtcgc
ccgtctccatgggaccgctggagagctggcggtggtgaccaggacacggagtggagcagg
atggagagctggcggcaggagaaggtggagcagatcctgtccgagttccgtctgaaggag
gaggacctgcggaaggtgatgcaccgcatgcagaaggagatggaccgcgggctgaagctg
gagacgcacgaggaggcgtcggtgaaaatgctgcccacctacgtgcgctccacccccgag
gggtcggaggtcggggatttcctctcgctggatctgggcggcaccaacttccgcgtgatg
ctggtgaaggtgggtgagggcgaggaggggcagtggaaggtgaagacgaagcaccagatg
tactccatccccgaggacgccatgacggggacggccgagatgctcttcgactacatctcg
gagtgcatctccgacttcctggacaagcaccagatgaagcacaaaaagctgcccctgggc
ttcaccttctccttccccgtgcggcacgaggacatcgacaagggcatcctgctgaactgg
accaagggcttcaaggcctcgggagcagaggggaacaacgtggtggggctgctgcgggac
gccataaaacggcgcggggactttgagatggacgtggtggccatggtgaacgacaccgtc
gccaccatgatctcctgctactacgaggaccaccgctgcgaggtcggcatgatcgtgggg
acgggctgcaacgcctgttacatggaggagatgcacaacgtggagctggtggagggcgac
gagggccgcatgtgtgtgaacacggagtggggcgcatttggggcgtcgggggagctggac
gagttcctgctggagtacgaccgcgtggtggacgagacctcgcttaaccccggtcagcag
ctctacgagaagatcatcgggggcaaatacatgggggagatcgtgcggctggtgctgctg
cggctggtggatgagaacctgctgttcagcgggcaggcctgcgagaagctcaagacacgc
ggggccttcgagacgcgcttcgtgtcacaggtggagagcgactcaggagaccgcaagcag
atctacaacatcctcacagccttcgggctgctgccctcggggtcggactgcgacatcgtg
cgcatggtgtgcgagagcgtgtccacacgcgctgcccagatgtgctcagccgggctggcc
ggcgtcatcaaccgcatgcgggagagccgcagccaggagaccctcaagatcaccgtgggg
gtggacggctctgtctacaagctgcaccccagcttcaaggaccgtttccacgccacggta
cgacagctgactcccggctgcgacatcaccttcatccagtcggaggagggcagcgggcgc
ggcgccgcgctcatctcggccgtggcctgcaagatggcgtgcatgatggggcagtga

DBGET integrated database retrieval system