KEGG   Gallus gallus (chicken): 430370Help
Entry
430370            CDS       T01006                                 

Gene name
GCK
Definition
glucokinase (hexokinase 4)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    430370 (GCK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    430370 (GCK)
   00052 Galactose metabolism
    430370 (GCK)
   00500 Starch and sucrose metabolism
    430370 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    430370 (GCK)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    430370 (GCK)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    430370 (GCK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     430370 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
22
AA seq 501 aa AA seqDB search
MLDHRSRMESWRQEKVEQILSEFRLKEEDLRKVMHRMQKEMDRGLKLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLRLVDENLLFSGQACEKLKTRGAFETRFVSQTVPHGGPLCHHPTAAVSDRPLLR
PLCHHPMVTFYSCPVLGFPTSLLHVGHQDPQPRLPTPASYIRVSFAITPAHSNSCPKLGP
SPSRHPTSALCSCLRWSPLSYWPGLESPIPLPHFGTLFPLSPCQPSRTVPMEVPCAITPM
TTLYDCPTLGFPAPSPHTSPL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccacaggagcaggatggagagctggcggcaggagaaggtggagcagatcctg
tccgagttccgtctgaaggaggaggacctgcggaaggtgatgcaccgcatgcagaaggag
atggaccgcgggctgaagctggagacgcacgaggaggcgtcggtgaaaatgctgcccacc
tacgtgcgctccacccccgaggggtcggaggtcggggatttcctctcgctggatctgggc
ggcaccaacttccgcgtgatgctggtgaaggtgggtgagggcgaggaggggcagtggaag
gtgaagacgaagcaccagatgtactccatccccgaggacgccatgacggggacggccgag
atgctcttcgactacatctcggagtgcatctccgacttcctggacaagcaccagatgaag
cacaaaaagctgcccctgggcttcaccttctccttccccgtgcggcacgaggacatcgac
aagggcatcctgctgaactggaccaagggcttcaaggcctcgggagcagaggggaacaac
gtggtggggctgctgcgggacgccataaaacggcgcggggactttgagatggacgtggtg
gccatggtgaacgacaccgtcgccaccatgatctcctgctactacgaggaccaccgctgc
gaggtcggcatgatcgtggggacgggctgcaacgcctgttacatggaggagatgcacaac
gtggagctggtggagggcgacgagggccgcatgtgtgtgaacacggagtggggcgcattt
ggggcgtcgggggagctggacgagttcctgctggagtacgaccgcgtggtggacgagacc
tcgcttaaccccggtcagcagctctacgagaagatcatcgggggcaaatacatgggggag
atcgtgcggctggtgctgctgcggctggtggatgagaacctgctgttcagcgggcaggcc
tgcgagaagctcaagacacgcggggccttcgagacgcgcttcgtgtcacagactgtccca
catgggggtcccctgtgccatcaccctacagcagctgtctctgatcgtcccttattgagg
cccctgtgccatcatcccatggtaaccttctacagctgcccagtattggggttccctacc
tcgttgcttcatgttgggcaccaggatccccagccccgtctccccacaccagcgtcctac
atcagggtctcctttgccattaccccagctcactctaatagctgtcccaaattgggaccc
tccccatctcgtcaccccacatcagccctctgtagctgcctacgttggagtcccctatcc
tactggcctgggttggagtcccctatcccactaccccactttgggaccctctttcctctt
agcccatgccagccctccagaactgtccccatggaggttccctgtgccatcacccccatg
acaacgctctacgactgccccacgttggggttccctgccccatcaccccacaccagccct
ctgtag

DBGET integrated database retrieval system