KEGG   Gallus gallus (chicken): 430487Help
Entry
430487            CDS       T01006                                 

Gene name
UNC13A
Definition
(RefSeq) unc-13 homolog A (C. elegans)
  KO
K15293  
protein unc-13 A/B/C
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
28
AA seq 1783 aa AA seqDB search
MSLLCVGVKKAKFDGPQEKFNTYVTLKVQNVKSTTIAVRGNLPAWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMTDNEISGTKDPTFHR
ILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDDYAFQEEQEKPLPVHGSQCCNWNYF
GWGEQQNDDPDSTVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYPMRHQQQSSRDSYT
DSMQSYEMDYSDQRPIRRYGSVDSAPNGRSDAESASASSRRTSRQPSLESRRSLDLSDSP
TGSSRYASSAELSQGSSQLSEDFENESLRDSELDERDGDSYHSCHSSVSYRKDSPRWEED
EDDDLYLEEEEEEEEEFNEDYSENEEGYPKEEEEEEEEEELREPGAYEAPERDAYPTPQK
PQQQQQVPQAKPQQQERKEERKEERKEERKEERKEEQDASAPQETPEVQKDEAPMQEPAP
EPEPPKQDEREPVEAEVQDPKARAKANWLRAFNKVCLQLQEARGEGDGEAKSLWFKGGGA
AVRFLRCINSMPDIKPGRKSLPLVSDLAMSLVQSRKAGITSALASSTLNNEELKNHVYKK
TLQALVYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCAECGVKCHEKCQDLL
NADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEVFGVTKTTHTQQ
MKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNL
NPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEM
DVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVTDLQNNGVV
KIPDAKGDDAWKVYFDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMST
LLANINAYYAHTTASTNVSASDRFAASNFGVSPMKERFVKLLDQLHNSLRIDLSMYRNNF
PASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNC
HELYSREYQTDPNKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQ
ELNVGKISAEVMWNLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVTELPSFK
SRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQ
LNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYAEIISKDFASYCSKEKEKVPCIL
MNNIQQLRVQLEKMFEAMGGKELDTEASDILKELQVKLNNVLDELSRVFATSFQPHIEEC
VKQMGDILSQVKGTGNVPASTCSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVL
KELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGTEKSRVKLPSHTEGTQMIFNAAKE
LGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLR
YALSLYTQATDLLIKTFVQTQTSQVHGGKGVRFTLSEEIYPEKGSGVEDPVGEVSIHVEL
FTHPGTGEHKVTVKVVAANDLKWQTSGIFRPFIEVNIIGPHLSDKKRKFATKSKNNSWAP
KYNESFQFTLGTETGPECYELQVCVKDYCFAREDRTVGIAVLQLRDLLQRGGCACWLPLG
RRIHMDDTGLTVLRILSQRNNDEVAKEFVKLKSDTRSAEEGST
NT seq 5352 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctctgcgtcggagttaaaaaggccaaattcgacgggcctcaagagaagttc
aacacctacgtgacgctgaaggtgcagaatgtcaaaagtaccaccatcgcggtgcggggc
aacctgcctgcctgggagcaggacttcatgtttgagatcaatcgcctggacctgggcctg
acagtggaggtgtggaacaagggccttatttgggacaccatggtggggacggtgtggatc
ccattgcgcaccatccggcagtccaacgaggagggccccggggaatggctgactctcgac
tcgcaggtcattatgactgacaatgagatttcaggcaccaaggaccccaccttccaccgc
atcctcctggacacccgctttgagctgccgttggacatccccgaggaggaggcgaggtat
tgggcaaagaagctggagcagctcaacgccatgcgggaccaggacgattatgccttccag
gaggagcaggagaagcctctgcccgtgcacggctcccagtgctgcaactggaattatttt
ggctggggagagcagcagaacgacgatcccgacagcacggtggatgaccgggatagcgat
taccgcagcgagaccagcaacagcatccccccaccctactacaccacctcgcagcccaac
gcctcggtgcaccaataccccatgcggcaccagcagcagagctcccgcgactcctacacc
gactccatgcagagctacgagatggactactcagaccagcggcccatcagacgctacggt
agcgtagattctgccccaaacgggcgcagcgacgctgagtccgcttcggcgtccagcagg
cggaccagccgccagccttcccttgagagcaggcggtccttagacctatcggatagcccc
acggggagcagccgctacgcctcatcagccgagctgagccagggcagctcccagctgagc
gaggacttcgagaacgagagcctgcgggactcagagctggacgagcgggatggagactcc
taccactcctgccacagctccgtcagctaccgcaaggactcgccacgctgggaggaggat
gaggacgatgacctctacctggaggaggaggaggaggaggaggaagagttcaatgaggac
tacagcgagaatgaggagggctaccccaaggaggaggaggaggaggaggaggaggaagag
ctgcgggagccgggtgcctacgaagcccctgagcgcgacgcctatcccacaccacagaaa
ccacagcagcagcagcaggtcccgcaggcgaagccacagcagcaggaaaggaaagaggag
aggaaggaggagaggaaggaagagaggaaggaggagaggaaggaggagcaggatgcgtct
gccccacaggagaccccagaggtgcagaaagatgaagctcccatgcaggagccagcacca
gaacccgagcccccaaaacaggatgagagggagccggtggaagcggaggtgcaggacccc
aaagcacgagccaaagccaactggctgcgagccttcaacaaggtctgcctgcagctgcag
gaggctcgtggggaaggcgatggagaagctaaatctctttggttcaaaggcgggggggcg
gctgtaaggtttctgcgctgcattaacagcatgcccgacattaagcccggacgcaaatct
ctccctctagtcagcgatctggcgatgtccttggtccagtccaggaaagcgggaatcaca
tccgcgttggcctccagcaccttgaacaacgaggagctgaaaaatcatgtttacaagaag
accctgcaagccttagtgtaccccatctcctgcaccacgccccacaacttcgaggtgtgg
acggccaccacccccacctactgctacgagtgcgaggggctgctgtggggcatcgcccgg
cagggcatgcgctgcgccgagtgcggtgtcaagtgccatgagaagtgccaggacctgctc
aacgccgactgcctgcagagggcggcagagaagagctccaagcacggagccgaggatcgc
acgcagaacatcatcatggtgctgaaagaccgcatgaagatccgcgagcgcaacaagccg
gagatcttcgagctgatccaggaggtgtttggggtcaccaagaccacgcacacgcagcag
atgaaggcggtgaagcagagcgtcctggatggcacctccaagtggtcggccaagatcagc
atcacggtggtttgtgcccagggcctgcaagcaaaggataagacgggctccagcgacccc
tatgtgaccgtccaggttggaaagacgaaaaaaaggactaaaaccatctatggcaatctc
aacccggtctgggaggagaatttccattttgagtgccataactcctccgaccgcatcaaa
gtccgtgtctgggatgaggatgacgacatcaagtcccgcgtcaagcagcgcttcaagagg
gagtccgacgacttcctgggccaaaccatcatcgaggtgcggacgctgagcggggagatg
gacgtctggtacaacctggacaagcggacggacaagtcggccgtgtcgggagccatccgg
ctgcacatcagcgtggagatcaagggcgaggagaaggtggccccgtaccacgtgcagtac
acgtgtctgcacgagaacctcttccacttcgtgacggatttacaaaacaacggcgtggtg
aagatccccgacgccaaaggggacgacgcctggaaggtgtacttcgatgagacggcgcaa
gagatcgtggatgagtttgccatgcgctatggggtggaatccatctaccaggccatgacg
cactttgcttgcctctcctccaaatacatgtgcccgggggtgccggcggtgatgagcacc
ctcctcgccaacatcaacgcttactacgcccacaccaccgcctccaccaacgtctccgcc
tccgaccgctttgccgcttccaatttcggggtaagtccgatgaaagaacgcttcgtcaaa
ctcctcgaccagctgcacaactccctgcgcatcgacctctccatgtaccggaacaacttc
cctgccagcagtcctgagcggctgcaggacctcaagtccacagtggatttgctgaccagc
atcacctttttccggatgaaggtccaggagctgcagagcccaccccgagccagccaggtg
gtgaaggactgcgtgaaggcgtgcctcaactccacctatgaatacatcttcaacaactgc
cacgagctctacagccgcgagtaccagaccgacccgaacaagaaaggcgaggtgcccccc
gaggagcaggggcccagcatcaaaaacctggatttctggtccaagctcatcaccctgatc
gtgtccattattgaggaggacaagaactcctacacgccctgcctgaaccagttcccccag
gagctgaacgtggggaagatcagcgccgaggtgatgtggaacctctttgcccaggacatg
aagtacgcgatggaggagcacgacaagcaccgcctgtgcaagagcgcggactacatgaac
ctgcacttcaaggtgaagtggctgtacaacgagtacgtcaccgagctgccctccttcaag
agccgcgtcccggagtaccccgcatggttcgagccctttgttatccagtggttggatgag
aacgaggaggtgtcgcgggatttcctgcacggagcgctggagcgcgacaagaaggacggg
ttccagcagacgtcggagcacgcgctcttctcctgctccgtggtggacgtcttctcccag
ctcaaccagagctttgagatcatcaagaaactcgagtgccccgacccgcagattgtcggg
cactacatgcggaggttcgccaagaccatcagcaacgtgctgctgcagtacgctgagatc
atctccaaggatttcgcctcatactgctccaaggagaaggagaaagtgccctgcatcctg
atgaacaacatccagcagctccgcgtccagctggagaagatgttcgaggccatggggggg
aaggagctggacacagaagccagtgacatcttaaaggagctgcaggtgaagctcaacaac
gtcctggatgagctgagccgagtgtttgccaccagcttccagccccacattgaggaatgc
gtcaagcagatgggggacatcctgagccaggtgaagggcaccggcaatgtccccgccagc
acctgcagcagcgtggcacaggatgctgacaacgtcctgcagcccatcatggacctgctg
gacagcaacctgacactcttcgccaagatctgcgagaagacagtgctgaagcgcgtgctg
aaggagctctggaagctggtgatgaacaccatggagaagaccatcgtgctgccaccgctc
accgaccagacgatgattggcacgctcttgagaaaacatggcaaagggacagagaagagc
agggtgaagctgcccagtcacactgaaggcacgcagatgatcttcaacgcagccaaggag
ttggggcagctctccaagctgaaggaccacatggtgcgggaggaagccaagagcctgacc
cccaaacagtgcgcggtggtggagttggcgttggacaccatcaagcaatacttccacgct
ggcggtgtggggctgaagaagaccttcctggagaagagccccgacctgcagtcgctgcgc
tacgcgctgtccctgtacacgcaggccaccgacctgctcatcaaaaccttcgtgcagacg
cagacatcacaagtccatggtggaaaaggtgttaggtttacccttagtgaagagatttat
cctgagaagggatccggagtggaggaccccgttggggaagtgtccatccacgtggagctc
ttcacccaccccggcactggcgaacacaaagtcactgtgaaagtggtggctgccaatgac
ctgaagtggcagacgtcgggcatcttccggcccttcattgaggtcaacatcatcggcccc
cacctgagtgacaagaagaggaaatttgccaccaagtccaagaacaacagctgggccccc
aaatacaacgagagcttccagttcacgctggggacggagacgggccccgagtgctacgag
ctgcaggtgtgcgtgaaggattactgcttcgcccgcgaggaccgcacggtgggcatcgcc
gtgctgcagctgcgcgacctcctgcagcgggggggctgcgcctgttggctgcccctcggc
cgccgcatccacatggacgacaccgggctgaccgtgctgcgcatcctatcccagcgcaac
aacgacgaggtggccaaggagttcgtcaagctcaagtccgacacgcgctcagctgaggag
ggcagcacttaa

DBGET integrated database retrieval system