KEGG   Gallus gallus (chicken): 430557Help
Entry
430557            CDS       T01006                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    430557 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    430557 (ACACB)
   00640 Propanoate metabolism
    430557 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    430557 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    430557 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    430557 (ACACB)
Enzymes [BR:gga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     430557 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     430557 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
15
AA seq 2370 aa AA seqDB search
MLLAAVLPMIFALLILTKMSTLNARNEDETPEQSPAPQPTPELAASPNPAAPSPPLQPTL
GGEQEQIAVYNPTALRRPTLAKFVLGSFEDNSSDDEVVAAAFRVSSRRSSLANAGAEPPA
THAPQEPAVGIRPSMSGLNLTKRGREHRKMDLQRDFSVASPAEFIARFGGTRVIEKVLIA
NNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIRMADHYVPVPGGANN
NNYANVELIVDISKRIPVQAVWAGWGHASENPKLPELLQKNGIAFLGPPSDAMWALGDKV
ASTIVAQTVQIPTLPWSGSGLVAQWSEEDQKDQQMISIPLETYGQGCVKDVEEGLEVAKR
IGYPLMIKAAEGGGGKGIRKVEAAEEFGACFRQVQAEAPGSPIFLMKLAQHARHLEVQVL
ADEYGNAISLFGRDCSIQRRHQKIIEEAPITIAAPAVIEVMEKCAVRLAQMVGYVSTGTV
EYLYSEDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGIPLHRIKDIRMLYGES
PWGDTPICFNSPANPPVPRGHVIAARITSENPEEGFKPSSGTVQELNFRSSKNVWGYFSV
AAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESF
QSNEIDTGWLDHLIAEKVQAEKPDTMLGVVCGALNVADAAFRTCMTDFLHSLERGQVLPA
ASLLNIIDVELIYEGTKYVLQVARQSLTTYVIIMNHTHIEIDVHRLTDGGLLLSYDGNSY
TTYMKEEIDRYRITIGNKTCDFEKEKDPTVLRSPSAGKLLQYTVDDGGHVAEGSVFAEIE
VMKIIMTLTVEEAGRVHYVKRPGALLEAGCVIAQLELDDPTKVKPAQPFTGGLPAQQTLP
ITGEKQHQVLRNVLDNLTNVMNGYCLPEPYFSSKVKEWVAQLMKTLRDPSLPLLELQEIM
TSISGRIPLSVEKSIRKVMAQYASNITSVLCRFPSQQIANVLDTHAATLQRKAEREVFFM
NTQSVVQLVQRYRSGIRGYMKAVVLDLLRRYLQVEMQFQQAHYDKCVISLREQYKPDMTP
VLESIFSHAQVAKKNLLVTMLIDQLCGREPTLTDELTAILNELTQLSKTEHSKVALRARQ
VLIASHLPSYELRHNQVESIFLSAIDMYGHEFCPENLKKLILSETTIFDVLPFFFYHDNQ
VVRMAALEVYVRRGYIAYELNSLQHRQLSDGTCLVEFQFMLPFSHPNSHLSTPRRMSVPI
SISNPDLARHSTELFMDSGFSPLSQRMGAMVAFNKFEDFTRNFDEVISCFAEPPLESSLF
SEARATIYGEEDAKNIREEPIHILNIALRRADHAEDEKLVPIFRAFAQSKKNILVDCGLR
RITFLIAQQVSADXMLTGWLYREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELSRMRN
FDLTAIPCANHKMHLYLGAAKVQAGTEATDYRFFIRAIVRHSDLITKEASFEYLQNEGER
LLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVVMDPSKIEESVRAMVMRYGSRLWKLRV
LQAEVKINIRLTPTTTAIPIRLSLTNESGYYLDISLYKEVRDPSTGNVSTAQILLTPNPS
SRLCALFFQAVSCVVSLQALFKLWGSSELHPKDVLTYTELVLDSQGQLVQMNRLPGGNEV
GMVAFKMKLKTPEYPKGRDIMLICNDITHMIGSFGPEEDLVFLRASELARAEGIPRVYIA
ANSGARIGFADEIKHMFQVAWVDPEDPYKGFKYLYLTPQDYTRISAMNSVHCEHVEEGGE
SRYVLLDIIGKDHGFGVENLRAAGTIAGESSRAYDEIVTISMVTCRAIGIGAYLVRLGQR
VIQVENSHIILTGVTALNKVLGREVYTSNNQLGGVQVMHNNGISHITVPDDFEGVYTILQ
WLSYMPKDNRSPVPVIAISDPIEREIDFVPSKVPYDPRWMLAGRPHPTLKGTWQSGFFDQ
GSFLEIMKPWAQTVVVGRARLGGLPVGVIAVETRTVEVTIPADPANPDSEAKIIQQAGQV
WFPDSAFKTAQAIRDFNREHLPLMIFANWRGFSSGMKDMYDEMLKFGAFIVDSLRDFKQP
VLVYIPPHAELRGGSWVVMDPTINPLYVELYADKESRGGILEPGGTVEIKFRKKDLVKTM
RRIDKVYAKLVEQLGTPELSEGQRKELEKQLKAREELLLPIYYQVAVHFADLHDTPGRMQ
EKGVITDILEWKNARSFLYWRLRRLLLEEVVKLEILKANSELSHIHIQSMLRRWFMETEG
AEKGYLWDNNQVVVEWLEKHMQEDDGSKSAIRENIKYLKRDYVLKRIRSLVQANPEVAMD
CIIQMAQHITRAQKAQVAHLLSTVDSESPS
NT seq 7113 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggcagccgtgctcccgatgatctttgcactgctcatcttgaccaagatgtcc
accttaaacgccagaaatgaggacgagacccctgagcagagcccggccccacagcccacc
ccagagctggcagcctccccaaaccccgcagcccccagccccccattgcagcccaccttg
gggggggagcaggagcagattgcagtgtacaaccccaccgcgctccgccggcccaccctg
gccaagttcgtgctgggctcctttgaggacaactcctctgatgatgaggtggtagctgca
gctttcagggtgagcagccgccgcagcagcctggccaatgcaggtgctgagccccctgcc
acacatgctccacaggaacccgctgttggcataaggcctagcatgtctgggctgaacctg
acgaagcgcggccgcgagcaccgcaagatggacctgcagagggacttctccgtcgcctca
cccgctgagttcatcgcccgcttcggggggacccgcgtcattgagaaggtcctgattgcc
aacaatggcatcgctgctgttaaatgcatgcgctccattcgccgctgggcttatgagatg
ttccgaaacgagcgcgccattcggtttgtggtcatggtcacccctgaagatctcaaggct
aacgcagagtacatcagaatggcagatcactacgtgcctgtccccggaggggccaacaac
aacaactatgccaacgtggagctgattgtggacatttccaaacggatcccagtccaggcg
gtgtgggctggctggggacatgcctcggaaaaccccaagttgccagagctgctgcagaaa
aatgggatagctttcctaggtccccccagtgatgccatgtgggcactgggggataaagtt
gcctccaccatcgtggctcagacggtccagataccaacgctgccatggagtgggagtggt
ctggtggcccagtggtctgaggaggaccagaaggaccagcagatgatcagcattcccctt
gagacgtatgggcagggctgcgtgaaggatgtggaagaaggcctggaggtggccaagagg
atcgggtacccgctgatgatcaaggcagcagaaggtggtgggggcaaaggcatccgcaaa
gtggaggcagcagaggagtttggagcctgcttccgacaggtgcaggcagaggcacctggg
tcccccatcttcctgatgaagctggcccagcatgcacggcacctggaggtgcaggtgctg
gctgatgagtatggcaatgccatctccctctttggccgtgactgttccatccagcgccgg
caccagaagatcatcgaggaggcacccatcaccattgctgctcctgctgtcatcgaggtg
atggagaagtgcgcggtacgcctggcgcagatggtgggctacgtgagcacgggcactgtc
gagtacctctacagtgaagatgggagcttccacttcctcgagctgaacccacgcctgcag
gtcgagcacccttgcacggagatgatcgcagatgtgaacctccctgctgcccagctccag
attgcgatgggcatccccttgcacaggataaaagacatccgaatgctgtatggggagagc
ccatggggcgatactcccatctgcttcaacagccctgccaacccccctgtgcccaggggc
cacgtcattgctgcacgcatcaccagtgagaaccctgaggagggtttcaagcccagctca
gggacggtgcaggaactgaatttccgcagcagcaagaatgtctgggggtacttcagtgtg
gcagctgctggggggctgcacgaatttgctgattcccagtttgggcactgcttctcgtgg
ggagagaacagagaggaggccatctcgaatatggtggtggccctaaaagagctctccatc
cgtggggatttccggaccacggtggaatatctgataaagcttttggagacggagagcttc
cagagcaatgagatcgacaccggctggctggaccatctgattgctgagaaagtgcaggca
gagaagccggacacgatgctgggtgttgtctgtggtgctctgaacgtcgcagatgctgcc
ttcaggacgtgcatgactgacttcctacactcactggagaggggccaggtgctgccagca
gcctccttgctgaacattattgacgtggagctcatctacgagggcacaaaatacgttctc
caggttgcccggcagtccttgaccacgtatgtcatcatcatgaaccacactcacatcgag
atagacgtgcaccggctgaccgacggcgggctgctgctctcctacgatggcaacagctac
accacctacatgaaggaggagatcgacaggtaccggatcacgattggcaacaaaacgtgt
gactttgaaaaggagaaggacccgacggtgctgcgctccccatctgcagggaagctgctg
cagtacacagtggatgatggaggccacgttgctgaggggagtgtttttgcagagatcgag
gtgatgaagatcatcatgacgctgacggtggaggaggcgggcagggtgcactacgtgaag
cggccgggtgcgctgctggaggcaggctgtgtcattgcacagctcgagctggatgacccc
accaaagtgaagcctgcacagccattcacaggggggctcccagcacagcagaccctcccc
attactggtgagaagcagcaccaggttctccgcaatgtgctggacaacctcaccaatgtc
atgaatgggtactgcctgcccgaaccctatttcagctccaaggtgaaggaatgggtggcg
cagctgatgaagaccctgcgggacccctccctgcccctcctggagctgcaggaaatcatg
acgagcatttcaggaagaatccctctctcggtggagaagtcaatccgcaaagtgatggct
cagtatgccagcaacatcacctccgtgctctgccgcttccccagccagcagatagccaat
gtgctggacacccacgcagccacgctgcagaggaaggctgagagggaggtgttcttcatg
aacacgcagagtgtggtgcagctggtgcagaggtaccgtagtggcatccgtggctacatg
aaggcggtggtgctggacctgctgagacgctacctgcaagtggagatgcagttccagcaa
gctcactatgacaagtgtgtcatcagtctgcgggagcagtacaaacccgacatgacccca
gtgctggagagcatcttctctcatgcccaggtggcaaagaagaacctgctggtgaccatg
ttaattgaccagctgtgcggccgggaacccacgctgacagatgagctgacagccatcctg
aacgagctgacgcagctcagtaagacagaacactccaaagtggcactgagagcccggcag
gttctcattgcctctcacctgccctcctatgagctgcggcacaaccaggtggagtccata
ttcctctctgctatcgacatgtatggacacgagttctgccctgaaaacctgaagaaactg
atcctctcagaaaccaccatcttcgacgtgcttccgttcttcttctaccatgacaaccag
gttgtgcgtatggcagcgctggaggtgtacgtgagacgtgggtatattgcctatgagctg
aacagcctgcagcatcggcagctctcggatggcacctgcctggtggagttccagttcatg
ctgcccttctcccacccaaatagccacctctctaccccacgcaggatgtctgtccccatc
agcatctccaaccccgacttggctcggcacagcactgagctcttcatggacagtggcttt
tcccccctgagccaacggatgggagccatggtggccttcaacaaatttgaggacttcacg
aggaactttgatgaagtgatctcctgctttgctgagccacctttggagagctccctcttc
agcgaggcacgagctaccatctatggggaggaggacgccaagaacatccgtgaggaacca
atccacatcctcaacatcgcgctccgccgggcggaccatgccgaggatgagaagctggtg
cccatcttcagagcctttgcccagtccaagaaaaacatcctcgttgactgtgggctccga
agaatcacgtttctcattgcccagcaggtcagtgcagactgaatgctgacagggtggctt
tatagagaattcccaaagtttttcacgttcagagccagggatgagtttgcagaggaccgc
atctaccggcacctggagccggcgctggccttccagctggagctgagccgcatgcgcaac
tttgacctcacagccatcccctgtgccaaccacaagatgcacctctacctcggggcagcc
aaggtgcaggcgggcaccgaggccaccgactatcgcttcttcatccgtgccattgtgcgg
cactcagacctcatcaccaaggaggcctcctttgagtacctgcagaacgagggtgagcgc
ctgctcctggaggcgatggatgagctggaggtggccttcaacaacaccagcgttcgcacc
gactgcaaccacatcttcctcaactttgtccccactgttgtcatggacccctccaagatc
gaggagtcggtacgggccatggtgatgcgctacggcagccgcctctggaagctgcgggtc
ctgcaggccgaggtgaagatcaacatccgcctgacgcccaccaccacggccatccccatc
cgcctctccctgaccaacgagtctggctactacctggacatcagcctctacaaggaagtg
agggaccccagcaccggcaacgtgagtactgcgcaaattctgctcacaccaaatcccagt
agcaggctttgtgccctgttcttccaggctgtctcatgcgtggtgtctctgcaggctctc
ttcaagctgtggggctcctcagagctgcatcccaaggatgtcctgacatacacagagctg
gtgctggactcgcagggacagctggtgcagatgaacaggctccctggagggaatgaggtg
gggatggttgccttcaaaatgaagctgaagacccctgagtacccaaagggccgggacatc
atgctcatctgcaacgacatcacacacatgattggctcctttgggccagaggaggacctg
gtgttcctgcgagcctcggagctggcacgggctgaaggcatcccacgtgtctacattgct
gccaacagcggtgcgcgtatcggctttgcagatgagataaagcacatgttccaggtggcc
tgggtggaccctgaggacccctacaaggggttcaagtacctgtacctgaccccccaggac
tacacgaggatcagtgccatgaactccgtgcactgtgagcacgtggaggaagggggtgag
tccaggtacgtcctattggacatcattgggaaggatcatggttttggggtggaaaacctg
cgagctgctggcaccatcgctggagagtccagtcgtgcttatgatgaaatagtgaccatc
agcatggtgacgtgtcgtgccattgggatcggtgcgtacctggtgaggctgggccagcgt
gtcatccaggtggagaactcccacatcatcctgactggggtcacagctctcaataaggtg
ttggggcgtgaagtttacacatccaataaccagctgggaggtgtgcaggtcatgcacaac
aatggtatttcccacatcactgtcccagatgactttgaaggagtctacactatcctgcag
tggctctcctacatgcccaaggataaccggagcccggtgcctgtcattgccataagtgac
cccatcgaaagagagattgattttgtcccttccaaagtcccctatgacccacggtggatg
ctggcagggagaccccatccaactctcaaggggacgtggcagagtggtttctttgaccag
ggaagcttcctggagatcatgaagccgtgggctcagacggttgtggttggcagagcgagg
ctgggaggtctccctgtgggcgtcattgctgtcgagacccgcactgtggaggtgacaata
cctgcagaccctgccaaccctgactcggaggcgaagataatccagcaggcaggacaggtc
tggtttccagactctgctttcaaaacagcccaggccattcgggacttcaaccgtgagcac
ctcccactgatgatcttcgccaactggaggggtttctccagcggcatgaaagacatgtat
gacgaaatgctgaagttcggtgctttcatcgtcgatagcctgcgggattttaagcagccc
gtcctggtgtacatcccgccccacgccgagctgcggggaggctcctgggtggtcatggac
cccaccatcaaccccctgtatgtggagctctacgcggacaaggagagcaggggcggcatt
ctggagcccgggggaacagtggagatcaagttcaggaagaaagatttggtgaagaccatg
agaaggatcgataaggtttatgccaagcttgtggagcagctggggacacctgaactgtct
gaggggcagcgcaaggagctggagaagcagctcaaggcccgggaggagctcctgctgccc
atatattaccaggtggccgtgcactttgctgacctgcatgacacccctggccgcatgcag
gagaaaggtgtcatcacggacatcctggagtggaagaacgcccgctcattcctctactgg
cggctgcgacggctgctgctggaagaggtggtgaagctggagatcctgaaagccaacagc
gagctgagccacatccacatccagtccatgctgaggcgttggtttatggagacagaagga
gctgagaaaggatacctctgggacaacaaccaggtggtggtggagtggctggagaaacac
atgcaggaggatgatggcagcaagtcagccatccgggagaacatcaagtacctgaaaagg
gactacgtgctcaagcgcatccggagcctggtccaagctaaccccgaggtggccatggac
tgcatcatccagatggctcagcacatcacccgcgcgcagaaggctcaggttgcccatctc
ctgtcgacggtggacagtgagagcccatcctga

DBGET integrated database retrieval system