KEGG   Gallus gallus (chicken): 431025Help
Entry
431025            CDS       T01006                                 

Gene name
SMUG1
Definition
(RefSeq) single-strand-selective monofunctional uracil-DNA glycosylase 1
  KO
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
gga  Gallus gallus (chicken)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    431025 (SMUG1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     431025 (SMUG1)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     431025 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
33
AA seq 332 aa AA seqDB search
MPCAGSGGGVKGRGQRAAAGPGAAQAQRPAGDGSMEERKDSAEPAVTTTEEDEEEEEEEG
GGLAERFLQLEKEHNALLRELPPFGAPVSHVYSPLDYAWEPHRDFVRRYCRGPKRVLFLG
MNPGPFGMAQTGVPFGETRHVREWLGVSGEVGKPPSEHPKRPVLGLTCKRAEVSGTRFWG
LVRTLCPDPHVFFRHCFVHNHCPLLFLAPSGRNLAPSELPPAQRVQLMGLCDRALARAVG
LLGVRMVVGVGRFAEQRARRALAAAGVTVRIEGFPHPSPRSARANKGWEEQARARLGELG
VLELFREGGGSPGGGRDGSEPPLVIKEEVEED
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcgcggggtcagggggcggggtcaaggggcggggtcagagggcggccgcgggg
cccggcgcggcgcaggcgcagcggccggcgggtgatggcagcatggaggagcgtaaggac
agcgcggagcccgcggtgaccacaacggaggaggacgaagaggaggaggaggaggagggg
ggggggttggcagagcgtttcctacagctggaaaaggagcacaacgcgctgctgcgggag
ctgccgcccttcggggcccccgtgagccacgtttacagccctctggactacgcctgggag
cctcaccgggacttcgtgcgccgctattgccgcggccccaagagagtcctcttccttggc
atgaaccccggccccttcggcatggcccagaccggggtccccttcggtgagacccgacac
gtccgcgagtggttgggggtcagcggtgaggtcgggaagccgccgtcggagcaccccaaa
cgtcccgtgttgggtctgacctgcaagagggcggaggtgagcggcacccgcttctggggg
ctcgtccggaccctctgccccgacccccacgtcttcttccgtcactgcttcgtccacaac
cactgtcccctcctcttcctcgcccccagcggtcgcaacctggccccgagcgagctgccc
cctgctcagcgggtccaactgatggggctgtgtgaccgggcgctggcgcgggctgtgggg
ctgctgggggtgaggatggtggtgggtgtggggcgttttgctgagcagagagcccgccgg
gctttggctgctgccggtgtgaccgtaaggatcgaaggcttcccgcacccctcaccccgc
agcgcccgcgccaataagggctgggaggagcaggcgagggcgaggctgggggagctgggg
gtgctggagctgtttcgggaggggggggggtcaccaggagggggcagggatggatctgag
ccgccgttggtcataaaggaggaggtggaggaggattag

DBGET integrated database retrieval system