KEGG   Gallus gallus (chicken): 431192Help
Entry
431192            CDS       T01006                                 

Gene name
SOS1
Definition
son of sevenless homolog 1 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    431192 (SOS1)
   04012 ErbB signaling pathway
    431192 (SOS1)
   04630 Jak-STAT signaling pathway
    431192 (SOS1)
   04068 FoxO signaling pathway
    431192 (SOS1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    431192 (SOS1)
  Cell communication
   04510 Focal adhesion
    431192 (SOS1)
   04540 Gap junction
    431192 (SOS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    431192 (SOS1)
   04912 GnRH signaling pathway
    431192 (SOS1)
  Development
   04320 Dorso-ventral axis formation
    431192 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
3
AA seq 1309 aa AA seqDB search
FSEENAPKWRGLLVPALKKVQVQVHPKLSSTEDALQYVEELILQLLNMLCQAQPRSFLDV
EDRVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYI
VAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDLSALTLSD
EEPSTSGEQTYYDLVKSFMAEVRQYIRELNLIIRVFREPYASNSKLFSSHDVENIFSRIS
DIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDMAEELAFDPYESYAQDILRPGFHDH
FLSQLSKPGAAFYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDEEDK
ECLKQAITALLNLQSSMERICSKSLAKRRLSESACRFYTQQMKGKQLAIKKMNEIQKNID
GWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRL
KEKFFMRKVQINDKDDTNEYRHAFEIILKDENSVIFAAKSAEEKNNWMAALISLQYRSTL
ERMLDVTMLQEEKEEQMRFPNPELYRFAEPDSEENIVFEENMQPKSGIPIIKAGTVVKLI
ERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRIAMENGDQPL
SAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRLEEFIGTVRGKAMKKWV
ESITKIINRKKQAQAIGPSHNITFESPPPAIEWHISKPGHTETFDLLTLHPIEIARQLTL
LESDFYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVI
VVSRIIEILQVFQELNNFNGVLEIVSAMNSAAVYRLDHTFEQIPSRQKKILEEAYELSED
HYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEFLKRHGKELINFSKRRKVAEITGE
IQQYQNQPYCLRVEFDIRRFFENLNPMGSSMETEFTDYLFNKSLEIEPRNVKPPPRFPKK
YSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETETTASAPNSPRTPLTPP
PASATSSTTDACSVFDSDPSSPFHARSASVSSISFTKTSDEAHVPPPVPPRRRPESAPAE
SSPSKITSAHLDSPPAIPPRQPTSKVYSPRYSVPDRTCISDPPESPPVLPPREPVRTPDV
FSSSPLHLQPPPLGRKSELGNTFFPNSPSPFTPPPPQTPSPHVARRHLPSPPLIQQDVDL
HSVAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLQNAHSS
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
ttcagcgaggagaacgcgcccaagtggcgggggctgctggtgcccgccctgaagaaggtt
caggtgcaagtccatcccaaactctcctctaccgaagatgcgttgcagtacgtggaggag
ctaattctccagttgctgaatatgttgtgtcaggcccagccgagaagttttctggatgta
gaggatcgtgttcagaaaagctttccccatcctattgataagtgggcaatagctgatgcc
cagtctgccattgagaaacgaaaacgaagaaatccgttatctctcccagtagaaaaaatc
catcctttattgaaggaggttctaggttacaaaattgaccaccaagtgtctgtttacata
gtggcagtattagaatacatttctgcagacatactaaaattggttgggaattatgtacga
aatataaggcattatgagattacaaaacaagatattaaagtggcaatgtgtgctgataag
gtgttaatggatatgttccatcaagatgtagaagatttaagtgcactaactttatctgat
gaggagccctccacgtcaggggagcagacctactacgacctagtgaagtcatttatggca
gaggttcggcaatatataagggaacttaatctcattatcagagtctttagagagccatat
gcctccaactccaaactattttcatctcatgatgtggaaaatatatttagtcgtatatca
gacattcacgaacttagtgtaaagttattgggtcatatagaagacactgttgaaatgaca
gatgaaggtagtcctcatccgttagtaggcagctgttttgaagatatggctgaggaacta
gcatttgatccatatgaatcgtatgcacaagatatcttgcgacctggttttcatgatcat
tttctaagtcaattatcaaagccaggagcagcattttatttacagtcaataggtgaaggc
tttaaagaagctgttcagtatgttctaccccggctgcttcttgcccctgtttaccactgt
cttcattattttgaactactaaaacaactagaagaaaaaagtgaggatgaagaggataag
gagtgcttgaagcaagcaataacagccctactgaatcttcaaagcagtatggaacggata
tgctccaaaagtcttgcaaaacgaaggcttagtgaatctgcgtgccgattctatactcag
cagatgaaggggaaacagctagcaattaagaagatgaatgaaatccagaaaaatatcgat
ggctgggagggtaaggacatcgggcagtgctgtaacgagttcatcatggaaggaacgctc
acacgcgttggagcaaaacatgagagacacatattcctatttgatggcttgatgatttgc
tgtaagtcaaatcacggccagccaagacttcctggtgctagcaatgcagaatatcgtctg
aaagaaaagttcttcatgcgaaaggtacaaatcaatgataaagacgacactaatgagtac
agacatgcttttgaaatcatcttaaaagatgagaacagtgttatttttgctgctaaatca
gctgaagagaaaaataactggatggcagcgttgatatctttgcaatatagaagcacgctg
gaaaggatgttggacgtaacgatgctgcaggaagaaaaagaggagcagatgagatttcca
aatcctgagctttacagatttgcagaacctgactcagaagagaatatcgtgtttgaagaa
aacatgcagcccaagtctggaatccccatcatcaaggcaggaactgttgtcaaacttatt
gagaggctgacttaccacatgtatgcagatcccaactttgttcggacttttctcacaaca
tacagatccttctgtaaaccccaggagttgctgagtctgctgatagaaagatttgaaatt
ccagaacctgagccaacagaagctgatcgtattgctatggagaatggagaccagcctctt
agtgctgagctaaaaagatttagaaaggagtacattcaacctgtgcagctacgggtatta
aatgtatgtcgacactgggtagagcaccacttctatgactttgaaagagatgctgatctt
ctgcagcgtttggaggaattcattggaacagtacgaggcaaagcaatgaagaaatgggta
gaatcaatcacaaagataatcaaccggaagaagcaggcacaagccattgggccaagtcac
aacatcacttttgaaagcccacctccagcgattgaatggcacataagcaaaccaggacac
acagagacttttgacttgctcactttgcatccaatagaaattgctcggcagctcacttta
cttgagtcagatttttacagagctgtgcagccatctgaactagttggaagtgtgtggacg
aaggaagataaagaaattaattctcccaatctcctcaaaatgataaggcatacaactaat
ctcactttgtggtttgaaaaatgcattgtagaaacagaaaacctagaggaaagagtaatt
gtagtgagccgaataattgaaatcctgcaagtttttcaagagctgaacaacttcaatggc
gtccttgagatcgtcagtgccatgaactctgcagcagtgtataggttggatcacacattt
gagcaaattccaagtcgtcagaagaagattttagaagaagcttacgaactgagtgaggat
cactataagaaatacttggcaaaactcaggtccattaatcctccttgcgtgccttttttt
ggaatttacttaactaacattttaaagacagaagaaggcaaccctgaatttctaaagcga
catggaaaagaactcataaatttcagcaagagaagaaaagtagcggaaataactggagag
atacaacagtaccagaaccagccatattgtttaagagtagaatttgacattaggagattt
tttgaaaacctgaatccgatgggaagcagcatggagacagaatttacagattatctgttc
aacaagtcgctagagatagagccacgaaatgtgaagcctccaccaagatttcccaaaaag
tacagctatcctctcaagtccccaggtgttcggccgtctaatccaaggccaggtaccatg
agacaccctacacccctgcaacaggaaccaagaaaaattagttacagccgcatcccagag
agtgagacagaaactacagcatctgcaccaaactctccacgaacgcctttgaccccaccc
cctgcttctgctacttcaagtactacagatgcctgcagtgtatttgactcagatccttca
agtccttttcatgcaagatctgcttctgtgtcatccataagctttaccaaaacttcagat
gaagctcacgttcccccaccagttcctccacgaagaagaccagagtctgccccagctgaa
tcctccccatcaaaaattacttctgcgcacctggacagcccgccagcaatccctcctagg
caaccaacctctaaagtgtattcaccaaggtactcggtgcctgaccggacctgcatctct
gacccccctgaaagccctcctgtgttaccaccaagagaacctgtgcgaactccagatgtt
ttctctagctcaccactacacctccagcctccaccactggggagaaaaagcgaacttggt
aacacctttttcccaaacagtccctctccatttacaccccctccccctcagacaccttct
ccacatgtagcacggagacatcttccatcaccacctttgatacaacaagacgtggacctc
cattctgtcgctggaccgcctgttcctccacgacaaagcacttctcaacatatcccaaag
cttcctccaaaaacttacaaaagggagcacacacacccatcgatgcatcgagacggaccg
cccttgctgcagaatgcccactcctcctga

DBGET integrated database retrieval system