KEGG   Gallus gallus (chicken): 431235Help
Entry
431235            CDS       T01006                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
11
AA seq 269 aa AA seqDB search
MALLWLLGCLVLAGSARATRSLPSCGVPAITPVIRGYNRIVNGEPAVPGSWPWQVSLQRY
GNFHFCGGSLISEQWVVTAAHCGVRTTDTVVLGEYDQETASSDVQRLGIAKVFRNPSYSS
LTIRNDITLIKLATPAQLNARVAPVCLPQATDDFPGGLTCVTTGWGLLNSNDENTPAILQ
QAALPLLTNAQCKQYWGFRIYDVMVCAGADGSSSCMGDSGGPLVCQKDGAWTLVGIVSWG
SSTCSTSTPGVYARVTKLREWIDSVLAAN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgtggctgctgggctgcctggtgctggcgggctctgcccgtgccacccgc
tctttgccgagctgcggtgtgcccgccatcacgcccgtcatccgtggctacaaccgcatc
gtgaacggggagccggcggtgcccgggtcctggccctggcaggtgtccctgcagcgctac
ggcaacttccacttctgcggcgggtcgctgatcagcgagcaatgggtggtcactgctgcc
cactgcggggtcaggaccaccgacaccgtggtgctgggcgagtacgaccaggagacggcc
tccagtgacgtgcagaggttgggcatcgccaaggtcttccggaaccccagctacagctcg
ctgaccatccgcaacgacatcacgctgatcaagctggccaccccagcacagctgaacgcc
cgcgtggcgcccgtctgcctgccccaggccaccgacgacttccccgggggcctgacctgc
gtcaccacgggctgggggctcctcaactccaacgatgagaacacgccggccatcctgcag
caagcggcccttcccctgctcaccaacgcgcagtgcaagcagtactggggcttccgcatc
tacgacgtgatggtgtgcgccggggccgacggatcctcctcctgcatgggcgactccggg
ggcccgctggtgtgccagaaggacggcgcctggacgctggtgggcatcgtctcgtggggc
agcagcacctgctccacctctacgcctggtgtgtacgcccgtgtcaccaagctccgcgaa
tggatcgactccgtgctggcggccaactga

DBGET integrated database retrieval system