KEGG   Gallus gallus (chicken): 769457Help
Entry
769457            CDS       T01006                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48 (EC:3.4.19.12)
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     769457 (USP48)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   769457 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
21
AA seq 1033 aa AA seqDB search
MAPRLQLEKAAWRWTETVPPEAVTQEHIEAAYRVGLEPCQRGTCRRNCRGNPNCLVGIGE
HVWLGEIDENSFHNIDDPNCERRKKNAFVGLTNLGATCYVNTFLQMWFLNLELRQALYLC
SSNEHAAGESIPKDKDYEPQTICEHLQYLFALLQNSKRRYIDPSGFVKALGLDTGQQQDA
QEFSKLFMSLLEDTLSKQKNPDVRNIVQKQFCGEYAYVTVCNQCGRESKLVSKFYELELN
IQGHKQLTDCITEFLKEEKLEGDNRYFCETCQSKQNATRKIRLLSLPCTLNLQLMRFVFD
RQTGHKKKLNTYIGFSELLDMEPFMEQKNGVYVYELSAVLIHRGVSAYSGHYIAHVKDPQ
TGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQT
REKSLTVEVPAFLQELVERDNCKFEEWCNEMAEMRKQSVARGKIKHEEVKELYQRLPAEA
GSPYDFISLEWLQKWLDESTPPKPIDNTACLCSHGKLHPDKICIMKRISEYVADFFYRRY
GGGPRLNVKALCKDCVVERCRILRLKNQLNEDYKTVTNLLKITVKGSEGFWVGKASLRSW
RQLALEQLNEQDEDAEHSNGKLNGNAPNKDEVNEEKREEEEELNFNEDIVCPHGDLCISE
NERRVVSKEAWKKLKQYFPKAPEFPSNKECCSQCKILEREGEENEALHKMMASEQKTSLQ
NLFHDKCRPCLGSWPQETDELYIVSQFFVEEWRKFVRRPTRCSPVSSLGNSALLCPHGGL
MFTYASMTKEDSKLIALIWPSEWERIQKLFVVDHVIKITRTRAAGEPESALYSSEPQLCP
ECRGGLLCQQQRDLREYTQATIYIHKVVDNKKVMKDAAPELNVSSSEAEEEREENKPEGE
QDPDFNQSNGGAKRQKLSHQSYISYQKQGIRRSTRHRKVRGEKALLVSANQTLKELKIQI
MHAFSVAPFDQNLLIDGKILSDDTATLGSLGIIPESVILLKADEPIADYAAMDDVMQVCM
PEEGFKGTGLLGH
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcggctgcagttagagaaggcggcctggcgctggaccgagacggtgccgccc
gaggcggtgacgcaggagcacatcgaggcggcctaccgcgtcggactggagccctgccag
cgcggcacctgccggaggaactgccgggggaaccccaactgcctggtgggcatcggggag
cacgtctggctgggcgagattgacgagaacagcttccacaacatcgatgatcccaactgc
gagcgccgcaagaagaacgcgtttgtgggcttaacaaacctcggcgccacgtgctacgtg
aacactttcttgcagatgtggtttcttaatctggaactccggcaagccctctacttatgt
tccagcaacgagcacgcagccggagagagcatccccaaagacaaagactatgagcctcag
accatttgtgagcatctccagtacttgtttgccttgctgcagaacagcaagaggcgatac
atcgatccctctgggtttgtcaaagcgctgggcttggatacaggccagcagcaggatgcc
caggaattttccaagctgttcatgtcgctgctggaagatactttatccaaacaaaaaaat
ccggacgttcgaaacattgttcagaaacagttctgtggggagtatgcctatgtcacagtc
tgcaaccagtgtggcagggagtccaaactcgtgtcgaagttttatgagctggagttaaac
atccaagggcacaaacagctgacagactgcattacggagtttctcaaggaagaaaaatta
gaaggggacaatcgttatttttgcgaaacttgtcagagtaaacagaatgccacaaggaag
atcaggctgctaagtcttccatgcacactcaacctgcagctgatgcgtttcgtgtttgac
agacaaactggccataagaaaaagctgaacacctacattggcttctccgagctgcttgac
atggaaccttttatggaacaaaaaaatggtgtctatgtgtacgaactgagtgctgtgctc
atacaccgaggtgtgagcgcatactcggggcactacatcgcccacgtgaaggacccgcag
acaggagagtggtacaaattcaacgacgaagacattgagaagatggaggggaagaagctg
cagctggggattgaggaagatctagcagagccttcgaaatcgcagacccgtaaacctaaa
tgtgggaaagggacgcactgctcccgcaacgcttacatgctggtgtacaggctgcagacc
cgggagaagtcactgacagtggaagtaccagctttcctgcaggagctggtggagcgcgac
aactgcaagtttgaggagtggtgcaacgaaatggccgagatgcgcaaacagagcgtggcc
aggggcaaaatcaagcacgaagaggtgaaggagctctaccaaaggttacctgctgaagct
ggttccccgtacgacttcatctctctggaatggctgcagaagtggctggatgagtccacc
cctcccaaacccatagacaacacagcctgcctgtgctcacacgggaagctgcatcccgac
aagatatgcataatgaagaggatatcggagtatgtggctgacttcttctacaggagatac
ggcgggggacccaggctgaatgtcaaagcactttgcaaggactgcgtggtagaaaggtgt
cgaatcctgcgtctgaaaaaccagctgaacgaagactacaaaactgtcaccaacttgctg
aagataacagtcaaggggagtgaggggttttgggttggaaaggcctccttgcggagctgg
cgtcagttggctctggagcaattaaatgagcaagacgaagacgcagagcacagcaatggg
aaactgaatggaaacgcaccaaacaaagatgaagtgaatgaggagaagagagaggaggaa
gaagagttaaattttaatgaagacattgtttgcccacatggtgacctgtgcatctccgag
aatgagaggagggtggtgtcgaaggaggcctggaagaagctcaagcaatatttcccaaag
gcccccgagttcccaagtaacaaagagtgctgttcccaatgcaagattttggagcgcgaa
ggagaagagaacgaagcgctgcacaagatgatggccagcgagcagaagacatccctccag
aacctgttccacgacaaatgccggccttgcttgggcagctggccgcaggagacagacgag
ctgtatatcgtttcacagttctttgtagaagaatggaggaaatttgtcaggaggccaacg
cggtgcagccccgtttcctcgctggggaacagcgctctgctctgcccccacgggggcctc
atgttcacctatgcttccatgaccaaagaagactccaagcttatagctctaatatggccc
agtgagtgggagaggattcaaaaactcttcgtggtggatcacgtcatcaaaatcacccgc
acgcgagctgccggggagcccgagagcgcactgtacagctctgagccccaactctgtcca
gaatgcagaggagggctgttatgccaacagcagcgggacttgcgtgagtacacccaagca
accatctacatccataaggtggtggataataaaaaggtaatgaaggatgctgctccagag
ctgaacgtgagcagctcagaagctgaagaggaaagggaggaaaacaagccagagggggag
caagacccagattttaaccagagcaatggcggtgcgaagcgccagaagctttcacaccag
agctacatctcctaccaaaagcaaggcatccggcggagcacccggcaccggaaggtcaga
ggagagaaagcgctgctcgtttctgctaaccagacattgaaagagctgaaaatacagatc
atgcatgcattttcagttgctcccttcgaccagaacttgttgattgatgggaagatcctg
agcgacgacacggcgacgctcggcagcctgggcatcatccctgagtccgtcatcctgctc
aaggctgatgagccaattgcagattatgcagcaatggacgatgtgatgcaagtttgtatg
cctgaagaaggatttaaagggactggcttactcggacactga

DBGET integrated database retrieval system