KEGG   Gallus gallus (chicken): 769763Help
Entry
769763            CDS       T01006                                 

Gene name
MAPK12
Definition
mitogen-activated protein kinase 12
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Influenza A
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    769763 (MAPK12)
   04370 VEGF signaling pathway
    769763 (MAPK12)
   04068 FoxO signaling pathway
    769763 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    769763 (MAPK12)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    769763 (MAPK12)
   04621 NOD-like receptor signaling pathway
    769763 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    769763 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    769763 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    769763 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    769763 (MAPK12)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    769763 (MAPK12)
   05164 Influenza A
    769763 (MAPK12)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     769763 (MAPK12)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   769763 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 361 aa AA seqDB search
MSSPKNGFYQQEITKTLWEVRDRYRDLQPVGSGAYGTVCSAVDGRSGAKVAIKKLYRPFQ
SQILAKRAYRELRLLKHMKHENVIGILDVFTPDVTLEKFNGFYLVMPFMGTDLSKIMKHE
KLTEDRIQFLVYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMT
GYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGRPLFRGNDHLDQLTEIMKITG
TPSQDFVQKLKSQDAKNYIKSLPKVQKKDFASVLKHASPLAVNLLENMLVLDAEERVTAA
EALMHPYFEPIHDPEEEIEAEKYDDTFDNMDLPLDEWKRITYKEILNFKPPQTSESKETA
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccccaagaacggcttctaccaacaggagatcaccaaaaccctctgggaagtg
cgggaccgctaccgggacctgcagcccgtgggctccggcgcctacggaaccgtctgctcc
gctgtggatggaagaagcggcgccaaagtggccattaagaagctgtaccgcccctttcag
tcccagatccttgccaagagagcctaccgagagctgcgcctcctgaagcacatgaagcac
gaaaacgtcattggaatactggatgtgttcacaccagatgtcacactggagaaatttaac
ggcttctacctggtcatgccatttatgggaacagacttaagtaagataatgaagcatgag
aaactcactgaagaccgaatccagttcttggtatatcagatattgaaaggcttaaagtat
attcactcatctggcataattcacagggatctaaagcctggaaacctggcagtaaatgaa
gactgcgaactgaagatcctggattttggattggccaggcatacggacagtgagatgaca
ggttacgtggttacaaggtggtacagagccccagaggtcatccttaattggatgcattac
acacaaacagttgacatctggtctgtgggctgtataatggctgaaatgataacggggagg
cctctgttcaggggaaacgaccatctggaccaactcacagaaataatgaaaataacgggt
acgccaagtcaagattttgtgcaaaaactgaagagtcaggatgcaaaaaactatatcaaa
agccttccaaaagtccagaaaaaagattttgcatccgtcttgaagcacgcgagtcctttg
gctgtaaatcttttggagaacatgctggtgctggatgcggaggagcgagtcacggcagct
gaggctttgatgcacccttactttgaaccaattcacgatcctgaggaagaaatcgaggct
gagaaatatgatgacacatttgataacatggatctgcccctggatgagtggaagcgtatt
acatataaagagatactgaacttcaagccaccacaaacatcagagtcaaaggagacagcg
gtgtaa

DBGET integrated database retrieval system