KEGG   Gallus gallus (chicken): 769763Help
Entry
769763            CDS       T01006                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04933  AGE-RAGE signaling pathway in diabetic complications
gga05132  Salmonella infection
gga05164  Influenza A
Module
gga_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    769763 (MAPK12)
   04370 VEGF signaling pathway
    769763 (MAPK12)
   04068 FoxO signaling pathway
    769763 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    769763 (MAPK12)
   04218 Cellular senescence
    769763 (MAPK12)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    769763 (MAPK12)
   04621 NOD-like receptor signaling pathway
    769763 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    769763 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    769763 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    769763 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    769763 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    769763 (MAPK12)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    769763 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    769763 (MAPK12)
   05164 Influenza A
    769763 (MAPK12)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     769763 (MAPK12)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   769763 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kdo Kinase-like UvrD_C
Motif
Other DBs
NCBI-GeneID: 769763
NCBI-ProteinID: XP_001233062
CGNC: 13849
Ensembl: ENSGALG00000019384
UniProt: F1NLU9
Position
1
AA seq 361 aa AA seqDB search
MSSPKNGFYQQEITKTLWEVRDRYRDLQPVGSGAYGTVCSAVDGRSGAKVAIKKLYRPFQ
SQILAKRAYRELRLLKHMKHENVIGILDVFTPDVTLEKFNGFYLVMPFMGTDLSKIMKHE
KLTEDRIQFLVYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMT
GYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGRPLFRGNDHLDQLTEIMKITG
TPSQDFVQKLKSQDAKNYIKSLPKVQKKDFASVLKHASPLAVNLLENMLVLDAEERVTAA
EALMHPYFEPIHDPEEEIEAEKYDDTFDNMDLPLDEWKRITYKEILNFKPPQTSESKETA
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccccaagaacggcttctaccaacaggagatcaccaaaaccctctgggaagtg
cgggaccgctaccgggacctgcagcccgtgggctccggcgcctacggaaccgtctgctcc
gctgtggatggaagaagcggcgccaaagtggccattaagaagctgtaccgcccctttcag
tcccagatccttgccaagagagcctaccgagagctgcgcctcctgaagcacatgaagcac
gaaaacgtcattggaatactggatgtgttcacaccagatgtcacactggagaaatttaac
ggcttctacctggtcatgccatttatgggaacagacttaagtaagataatgaagcatgag
aaactcactgaagaccgaatccagttcttggtatatcagatattgaaaggcttaaagtat
attcactcatctggcataattcacagggatctaaagcctggaaacctggcagtaaatgaa
gactgcgaactgaagatcctggattttggattggccaggcatacggacagtgagatgaca
ggttacgtggttacaaggtggtacagagccccagaggtcatccttaattggatgcattac
acacaaacagttgacatctggtctgtgggctgtataatggctgaaatgataacggggagg
cctctgttcaggggaaacgaccatctggaccaactcacagaaataatgaaaataacgggt
acgccaagtcaagattttgtgcaaaaactgaagagtcaggatgcaaaaaactatatcaaa
agccttccaaaagtccagaaaaaagattttgcatccgtcttgaagcacgcgagtcctttg
gctgtaaatcttttggagaacatgctggtgctggatgcggaggagcgagtcacggcagct
gaggctttgatgcacccttactttgaaccaattcacgatcctgaggaagaaatcgaggct
gagaaatatgatgacacatttgataacatggatctgcccctggatgagtggaagcgtatt
acatataaagagatactgaacttcaagccaccacaaacatcagagtcaaaggagacagcg
gtgtaa

DBGET integrated database retrieval system