KEGG   Gallus gallus (chicken): 769783Help
Entry
769783            CDS       T01006                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    769783 (EIF3B)
Translation factors [BR:gga03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    769783 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
14
AA seq 733 aa AA seqDB search
SEPPAESQAPQPSSPQPGSGRESPEQAEPKAESLPEEAKSEPPAEAEPPAEPCAPREDGE
AAPAEPEDELSFSDPEGFVDDISDEELLGDVLKDQPQEADGIDSVIVVDNVPQVGPDRLE
KLKNVIHKIFSKFGKIINEFYPEADGKTKGYIFLEYMSPSHAVDAVKNADGYKLDKQHTF
RVNLFTDFDKYMTISDEWEIPEKQPFKDLGNLRYWLEDPDCRDQYSVIFESGDRTSIFWN
DIKEPVQIEDRARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDF
SPCERYLVTFSPLMDTQDDPQAIIIWDILTGQKKRGFHCENSAHWPIFKWSHDGKFFARM
TSDTLSIYETPSMGLLDKKSLKINGIRDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPAR
QEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEM
KESIIAFAWEPNGSKFAVLHGETPRISVSFYHVKNNGKIDLIKTFDKQQANTIFWSPQGQ
FVVLAGLRSMNGALAFVDTSDCTMMNIAEHYTASDVEWDPTGRYIVTSVSWWSHKVDNAY
WLWTFQGRLLQKNNKDRFCQLLWRPRPATLLSEDQIKQIKKDLKKYSKIFEQKDRLSQSK
ASKELVERRRTMMEEFRKYRKMAQELYMEQRNERLELRGGVDTDELDSNVDDWEEETVEF
FINEEIITLAEPE
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
tcggagcctcccgccgagtcccaggcgcctcagccatcctcacctcagccggggtccggt
cgcgagagccccgagcaggctgagcccaaggccgagtcgctgccggaggaggccaagagc
gagccgccggccgaggccgagccgccagccgagccctgcgcgccgcgggaggacggagag
gccgcgcccgccgagcccgaggacgagctttccttcagcgatcccgagggcttcgtggac
gacatcagcgacgaagaattactcggtgatgtactgaaagaccagccacaggaagcagat
ggaattgattccgtgatagtagtggataacgttccccaggttggaccagaccgacttgag
aaactcaagaatgtcatccacaaaatattttccaagtttggtaaaattattaatgaattt
tatccagaagcagacggaaagacaaaagggtacatctttctggagtacatgtctccatct
catgcagtggatgctgtgaagaatgcagatggatacaaactggataagcagcacactttc
agagtcaatcttttcacagactttgacaagtatatgacaatcagtgacgagtgggaaatc
cctgagaaacagccatttaaagatttggggaatcttcgttactggttggaagatcctgat
tgtagggatcagtacagtgtgatctttgagtcaggagaccggacctccattttttggaat
gatatcaaggagcctgttcaaattgaggacagagcacggtggacagaaacctatgtacgt
tggtccccaaagggtacctatctggctacattccaccagaggggcattgcactttggggt
ggagagaagttcaagcagattcaaaggtttagtcaccaaggagtgcagcttattgacttc
tcgccctgtgaaagatatttagtgaccttcagccctttgatggacacacaggatgaccct
caggctattatcatctgggatattctgactgggcaaaagaaacgaggattccactgtgaa
aactcagctcactggcctatttttaaatggagtcatgatggtaaattctttgctcgaatg
acttcagatactctcagcatctatgaaacaccttctatgggattgttggacaaaaaaagc
ttgaaaatcaatgggataagagatttctcatggtctccgggcggtaacataattgctttc
tgggtgcctgaggataaagacatcccagcaagagtgaccttaatgcaactgcctgccaga
caagaaatccgtgtgcggaatttgttcaatgttgtagattgtaaactacactggcagaag
aatggtgattacctgtgtgtgaaggtagacaggactcccaaaggcacacagggagtagtg
accaactttgaaatattccgaatgagagagaaacaggtgcctgtggatgtggtggaaatg
aaagaaagcatcatagcttttgcttgggaaccaaatggaagcaagtttgctgtgttgcat
ggagaaactccacgaatttcagtgtcattttaccatgttaaaaacaatgggaaaatagat
ctcatcaaaacgtttgacaaacagcaggcaaacacgatattctggagtcctcaaggtcaa
tttgtagtgttggctggcctcagaagcatgaacggtgccttagcatttgttgatacgtct
gactgcaccatgatgaatattgctgaacactatacagcttcagatgtggagtgggatcct
acaggcagatacatcgtgacttctgtgtcctggtggagccataaggtggacaatgcatat
tggttatggaccttccaaggacgtctgcttcagaaaaacaataaggacaggttctgtcag
cttctgtggagaccacgtccagctaccttgctcagtgaagatcagataaagcaaattaag
aaggatctgaagaagtactcaaagatatttgagcagaaggatcgcctgagccagtccaaa
gcttcaaaagagctggtggaaaggaggcgtacgatgatggaagaattcaggaagtaccgc
aagatggcacaagagttgtacatggagcaaaggaacgagcgcttagagcttcgaggaggg
gtagacacggatgagctggacagcaatgttgatgactgggaggaggagactgttgaattt
tttatcaatgaagaaattattacccttgcagaaccagagtaa

DBGET integrated database retrieval system