KEGG   Gallus gallus (chicken): 769850Help
Entry
769850            CDS       T01006                                 

Gene name
PFKL
Definition
(RefSeq) phosphofructokinase, liver
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    769850 (PFKL)
   01230 Biosynthesis of amino acids
    769850 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    769850 (PFKL)
   00030 Pentose phosphate pathway
    769850 (PFKL)
   00051 Fructose and mannose metabolism
    769850 (PFKL)
   00052 Galactose metabolism
    769850 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    769850 (PFKL)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     769850 (PFKL)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     769850 (PFKL)
Messenger RNA biogenesis [BR:gga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     769850 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
9
AA seq 770 aa AA seqDB search
MAGAGMAIAVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGDNIKQATW
LSVSNIIQLGGTVIGSARCKAFTTRQGRCAPARNLVEHGITNLCVIGGDGSLTGADVFRA
EWAGLLDELLRDGLISEEVAKANGRLNVVGLVGSIDNDFCGTDMTIGTDSALHRIMEVID
AITTTAQSHQRTFVLEVMGRHCGYLALVSGLASGADWLFIPESPPEDGWEDLMCERLGET
RSRGSRLNIIIIAEGAIDRNGKPISSNYVKDLVVQRLGFDTRVTVLGHVQRVGTPSAFDR
VLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQKAMDEKRFDEA
IQLRGRSFENNWNIYKLLAHQKPAQEKSPFSLAILNVGAPAAGMNAAVRSAVRISICRGH
TIYAVSDGFEGLAKGQIREVGWHDVAGWLGRGGSMLGTKRTLPKTCMEKIVENVRKFNIQ
GLLVIGGFEAYEGVLQLVEARGQYEELCIIMCVIPATISNNVPGTDFSLGSDTAVNAAME
SCDRIKQSASGTTRRVFIVETMGGYCGYLCTVTGIAVGADAAYVYEDPFTIHDLKANVEH
LTDKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGIFDCRINVLGHLQQGGAPTPF
DRNYGTKLGVKAVLWMSEKLQEAYRKGRVFANSADSACVIGLRKKVVAFSPVTELKKVTD
FEHRLPQEQWWLNLRLMLKMLANYQISLTEYISGKMEHVTRRTLSIEKGF
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggccggcatggctatcgccgtgctcaccagcggcggcgacgcgcaaggcatg
aacgccgctgtgcgcgccgtcacccgcatgggcatctacgtgggagcaaaggtcttcctc
atctacgagggctacgaggggttggtggaaggcggcgacaacatcaagcaggccacctgg
ctgagcgtctccaacatcatccagctgggcggtacggtcatcggcagcgcccgctgcaaa
gccttcaccacgcggcagggccgctgcgcgcctgcccgcaacctggtggagcacggcatc
accaacctctgcgtcatcggcggcgatggcagcctgacgggcgccgacgtcttccgcgcc
gagtgggccgggctgctggatgagctgctgcgggacgggctgatcagtgaggaggtggcg
aaggccaacgggcggctcaacgtggtgggtttggtgggctccatcgacaatgacttctgc
ggcaccgacatgaccattggcaccgactcggcgctgcatcgcatcatggaggtgatcgat
gccatcactaccacagcgcagagccaccagaggacgttcgtgctggaggtgatgggccgc
cactgcgggtacctggcgctggtgtctgggctggcctcaggggccgactggctcttcatc
cccgaatcccccccagaggatggctgggaggacctgatgtgcgagcggctcggggagacc
cgcagccgagggtcacggctcaacatcatcatcatcgcggagggggccatcgaccgcaac
ggcaaacccatctcctccaactacgtcaaagacctggtggtgcagcgcctgggctttgac
acgcgtgtcactgtgctgggccacgtgcagcgggtggggacgccctcggccttcgaccgt
gtgctgagcagcaagatggggatggaggcggtgatggcgctgctggaggccaccccggac
acccctgcctgtgtggtcagcctgtcagggaaccagtcggtgcggctgccgctgatggag
tgcgtccaggtgacgaaggacgtgcagaaggccatggatgagaagaggttcgatgaggcg
atccagctccgtgggaggagctttgagaacaactggaacatctataaactgttggcgcac
cagaagccagcgcaggagaagagccccttcagcctggccatcctgaacgtgggggcccct
gctgccggcatgaatgcggccgtgcgctcagctgtgcgcatcagcatctgccgtggccac
accatctatgcagtgagcgatggcttcgagggcttggccaagggacagatacgtgaggtg
ggctggcacgacgtggcaggctggctgggacgtggtgggtccatgctaggcaccaagcgg
actctgcccaagacttgcatggaaaagatcgtggagaatgtgcggaaattcaacatccaa
ggtctgctggtcattggcggctttgaggcatacgagggagtgctgcagctggtggaagcc
cgtgggcagtatgaggagctctgcatcatcatgtgtgtcatccccgccaccatcagcaac
aacgtgcccggcaccgacttcagcctgggctcggacacagctgtcaatgcagccatggag
agctgtgaccgcatcaagcagtcggcgtcgggcaccacgcgccgcgtcttcatcgtggag
accatgggaggctactgtgggtatttgtgcactgtcaccggcatcgctgtgggtgccgat
gctgcctatgtgtatgaagatcccttcaccatccacgacctgaaggccaacgtggagcac
ctgacggacaaaatgaagacggacatccagagagggctggtgctgcgcaacgagaagtgc
cacgagcactacaccaccgagttcctctacaacctctactcctctgagggcaagggaatc
tttgactgcaggatcaacgtcctgggccacctccagcaggggggagccccgacccccttt
gaccgcaactatgggaccaagctgggcgtgaaggccgtgctgtggatgtcagagaagctg
caggaggcataccgcaaggggcgtgtgtttgccaactcggccgactccgcctgtgtcatc
gggctgaggaagaaggtggtggccttcagccccgtgacggagctcaagaaagtcactgat
tttgagcaccggctgccccaggagcagtggtggctgaacctgcggctgatgctgaagatg
ctggccaactaccagatcagcctgaccgagtacatctcggggaagatggagcacgtcacc
cggcgcacgctcagcatcgagaagggcttctag

DBGET integrated database retrieval system