KEGG   Gallus gallus (chicken): 770302Help
Entry
770302            CDS       T01006                                 

Gene name
UCHL1, UCH-L1
Definition
(RefSeq) ubiquitin C-terminal hydrolase L1
  KO
K05611  ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     770302 (UCHL1)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   770302 (UCHL1)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    770302 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 770302
NCBI-ProteinID: NP_001073681
CGNC: 10625
Ensembl: ENSGALG00000014261
UniProt: A1IMF0
Position
4
AA seq 224 aa AA seqDB search
MAWQPMEINPEMLNKVLSRLGVSPGWRFVDVLGFEEEALGAVPSPACALLLLFPLTEQHE
NFRKQQTEKIKDQEISSKVYFLKQTVSNSCGTIGLIHAVANNKDKVKLDEGSALKKFLDE
TADLSPEERAKRFANNKAIQEVHNSVAQEGQCRVEDNSVNFHFILFANVDGHLYELDGRL
PFPVNHGTSSDDLLLKDSAKICRQFTEREKGEVRFSAVAFCKSA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcagcccatggagatcaaccccgagatgctgaacaaagtgctgtcccgcctc
ggggtgagccccggctggcgcttcgtggacgtgctgggcttcgaggaggaggctctgggt
gccgttcccagcccggcctgcgccctgctgctcctcttccccctcaccgagcagcatgag
aactttaggaaacaacagactgagaaaataaaggaccaagaaatcagttccaaggtgtat
ttcctgaagcagactgtcagtaactcctgcgggacgattggtctgatacatgcagttgct
aataacaaagacaaagttaaacttgatgagggatctgccctgaagaaatttcttgatgaa
acagctgatctgtctcctgaagagagagctaagcgttttgcaaataataaggctatacaa
gaagtccacaactctgttgcacaggaaggacagtgtcgggttgaggacaacagtgtgaac
ttccacttcatcctgtttgctaatgtggatggacatctgtatgaactggatgggcgtttg
ccatttcctgtaaaccatggcacaagctcagatgacttgctattgaaggattctgctaag
atctgcagacaatttacagaacgtgaaaaaggagaagttcgtttttctgctgtggctttc
tgcaagtctgcctga

DBGET integrated database retrieval system