KEGG   Gallus gallus (chicken): 770302Help
Entry
770302            CDS       T01006                                 

Gene name
UCHL1, UCH-L1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
4
AA seq 224 aa AA seqDB search
MAWQPMEINPEMLNKVLSRLGVSPGWRFVDVLGFEEEALGAVPSPACALLLLFPLTEQHE
NFRKQQTEKIKDQEISSKVYFLKQTVSNSCGTIGLIHAVANNKDKVKLDEGSALKKFLDE
TADLSPEERAKRFANNKAIQEVHNSVAQEGQCRVEDNSVNFHFILFANVDGHLYELDGRL
PFPVNHGTSSDDLLLKDSAKICRQFTEREKGEVRFSAVAFCKSA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcagcccatggagatcaaccccgagatgctgaacaaagtgctgtcccgcctc
ggggtgagccccggctggcgcttcgtggacgtgctgggcttcgaggaggaggctctgggt
gccgttcccagcccggcctgcgccctgctgctcctcttccccctcaccgagcagcatgag
aactttaggaaacaacagactgagaaaataaaggaccaagaaatcagttccaaggtgtat
ttcctgaagcagactgtcagtaactcctgcgggacgattggtctgatacatgcagttgct
aataacaaagacaaagttaaacttgatgagggatctgccctgaagaaatttcttgatgaa
acagctgatctgtctcctgaagagagagctaagcgttttgcaaataataaggctatacaa
gaagtccacaactctgttgcacaggaaggacagtgtcgggttgaggacaacagtgtgaac
ttccacttcatcctgtttgctaatgtggatggacatctgtatgaactggatgggcgtttg
ccatttcctgtaaaccatggcacaagctcagatgacttgctattgaaggattctgctaag
atctgcagacaatttacagaacgtgaaaaaggagaagttcgtttttctgctgtggctttc
tgcaagtctgcctga

DBGET integrated database retrieval system