KEGG   Gallus gallus (chicken): 770321Help
Entry
770321            CDS       T01006                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gga00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
2
AA seq 229 aa AA seqDB search
MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWSEALAGIKSPHVKYICPHAPFMP
VTLNMNMAMPSWFDIIGLSPDSQEDEVGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTHQKLAGVVALSCWLPLRTSFVQGAVGVNKEIPVLQCHGDCDPLVPLMF
GSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtcggcgccgctccccgccatcgtcccggccgccaggaaggcg
acggccgccgtgatttttcttcatggactgggagataccgggcatggatggtcagaagca
cttgctggtatcaaaagcccccatgtaaaatacatttgcccacacgcgccatttatgcca
gttactttgaacatgaacatggctatgccatcatggtttgatatcattggactttctcca
gattcacaggaagatgaagttgggatcaaacaggcagcagagaatgttaaagcactgata
gatcaagaagtaaaaaatggaattccttctaatcgaattattctgggaggcttttctcag
ggcggtgctttatcattgtatacagctcttacaacgcatcaaaagttagcaggtgttgta
gccctcagctgttggcttcctctccggacttcttttgttcagggtgctgttggtgtcaac
aaggagattcctgttcttcagtgccatggggactgtgacccactcgttcctttaatgttt
ggttctcttactgttgagaagctaaagagtatgataaatccagccaatataaccttcaga
acttactctggcatgatgcatagttcatgtattgaggagatgatggatataaaacagttc
atagacaaacatctaccccctgtggactga

DBGET integrated database retrieval system