KEGG   Gallus gallus (chicken): 770321Help
Entry
770321            CDS       T01006                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    770321
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     770321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 229 aa AA seqDB search
MCGNNMSAPLPAIVPAARKATAAVIFLHGLGDTGHGWSEALAGIKSPHVKYICPHAPFMP
VTLNMNMAMPSWFDIIGLSPDSQEDEVGIKQAAENVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTHQKLAGVVALSCWLPLRTSFVQGAVGVNKEIPVLQCHGDCDPLVPLMF
GSLTVEKLKSMINPANITFRTYSGMMHSSCIEEMMDIKQFIDKHLPPVD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtcggcgccgctccccgccatcgtcccggccgccaggaaggcg
acggccgccgtgatttttcttcatggactgggagataccgggcatggatggtcagaagca
cttgctggtatcaaaagcccccatgtaaaatacatttgcccacacgcgccatttatgcca
gttactttgaacatgaacatggctatgccatcatggtttgatatcattggactttctcca
gattcacaggaagatgaagttgggatcaaacaggcagcagagaatgttaaagcactgata
gatcaagaagtaaaaaatggaattccttctaatcgaattattctgggaggcttttctcag
ggcggtgctttatcattgtatacagctcttacaacgcatcaaaagttagcaggtgttgta
gccctcagctgttggcttcctctccggacttcttttgttcagggtgctgttggtgtcaac
aaggagattcctgttcttcagtgccatggggactgtgacccactcgttcctttaatgttt
ggttctcttactgttgagaagctaaagagtatgataaatccagccaatataaccttcaga
acttactctggcatgatgcatagttcatgtattgaggagatgatggatataaaacagttc
atagacaaacatctaccccctgtggactga

DBGET integrated database retrieval system