KEGG   Gallus gallus (chicken): 770737Help
Entry
770737            CDS       T01006                                 

Gene name
GAMT, null
Definition
(RefSeq) guanidinoacetate N-methyltransferase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00260  Glycine, serine and threonine metabolism
gga00330  Arginine and proline metabolism
gga01100  Metabolic pathways
Module
gga_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    770737 (GAMT)
   00330 Arginine and proline metabolism
    770737 (GAMT)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     770737 (GAMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 770737
NCBI-ProteinID: XP_015155460
CGNC: 66651
Ensembl: ENSGALG00000040182
UniProt: A0A1D5P3Q3
Position
28
AA seq 237 aa AA seqDB search
MSALSDTAPIFTEGEDCKAAWQEATAAYDAPDTHLEILGKPVMERWETPYMHSLATVAAS
RGGRVLEVGFGMAIAATKVQEFNIEEHWIVECNDGVFQRLEEWARVQPHKVVPLKGLWED
VVPTLPDGHFSGILYDTYPLSAQTWHTHQFAFIKDHAFRLLRPGGVLTYCNLTSWGELLK
GKYSDIEKMFEETQVAQLLEAGFRRENISTAVMELVPPRECRYYSFPRMITPRVVKH
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccctctcagacacagctcccatattcaccgagggtgaggactgcaaggctgca
tggcaggaggccacggctgcctacgatgcccccgacacccacctggagatcctggggaag
ccggtgatggaacgctgggagaccccctacatgcattcgctggcgaccgtggctgcctcc
aggggtggccgtgtgctggaggtgggctttggcatggccattgctgccaccaaggtgcag
gagttcaacatcgaggagcactggatcgtggaatgcaacgacggcgtgttccaaaggctg
gaggagtgggcacgagtgcagccacacaaggtggtgccactgaaggggctgtgggaggat
gtggtgccaacgctgccggatgggcacttctctggaatcctatacgacacgtacccgctg
tctgcacagacctggcacacgcaccagtttgccttcatcaaggaccatgccttccgcctg
ctgcgacccgggggggtcctcacctactgcaacctcacctcgtggggggagctgctgaag
ggcaaatacagcgacatagagaagatgtttgaggagactcaggtggcacagctgctggag
gccggtttcaggagggagaacatcagcacagcagtgatggagttggtgcccccccgggag
tgccgctactactccttccctcggatgatcaccccccgcgtggtgaagcactga

DBGET integrated database retrieval system