KEGG   Gallus gallus (chicken): 770828Help
Entry
770828            CDS       T01006                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:gga01200]
Metabolism; Overview; Fatty acid metabolism [PATH:gga01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gga00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gga00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:gga00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gga00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:gga00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gga00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:gga00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:gga00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 301 aa AA seqDB search
MAASLRALLRPSAGACADAARRRAFLAALRPLVAGRGCSDGPPFRFLQVQKAGAGGSVGL
IRLQRPEALNALCAGLMEELRRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQ
ECYAGGFLAGWDRVATVRKPTIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
IPGAGGTQRLTRAVGKSLAMEMVLTGERISAAEAKAAGLVSKVFPVDKLLDAAIGCAEKI
AANSKLVVAMAKESVNAAFETTLTEGNRTEKRLFYATFATDDRKEGMTAFVEKRKANFTD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgttgcgcgccctcctccgtcccagcgccggtgcctgcgccgatgccgcg
cggcgccgcgcgttcctggcggcactccgcccccttgtggcggggcgggggtgcagcgac
ggtcccccgttccgcttcctccaggtgcagaaggccggggcgggcggcagcgtggggctg
atccggctgcagcggcccgaggcgctcaacgcgctctgtgcggggctgatggaggagctg
agacgcgcactggacgccttcgaggccgacgggcaggtgggagctattgtcatcaccggc
agtgagaaggcctttgcagccggcgctgacattaaagagatgcagaacaaaaccttccag
gagtgctatgctggcggcttcctggccggctgggaccgggtggccactgtccgcaagccc
accatcgccgctgttaatggcttcgctttgggcggcggctgtgaactggccatgatgtgc
gacatcatctatgccggggagaaggcgcagtttggacagcccgagatcctgctggggaca
atcccaggtgccggcgggacgcagaggctgaccagggcggtgggcaagtcgctggccatg
gagatggtgctgaccggggagcggatctcggcggcggaggccaaagcggcaggtctggtc
agcaaagtcttccccgtggacaagctgctggacgcggccattggctgcgctgagaagatc
gctgccaactccaagctggtggtagctatggccaaggagtccgtcaatgctgctttcgaa
acaacactgacagaggggaacaggacggagaagcgcctcttctatgccacttttgccacc
gacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggccaacttcactgac
agttga

DBGET integrated database retrieval system