KEGG   Gallus gallus (chicken): 770828Help
Entry
770828            CDS       T01006                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial (EC:4.2.1.17)
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    770828 (ECHS1)
   01212 Fatty acid metabolism
    770828 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    770828 (ECHS1)
   00650 Butanoate metabolism
    770828 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    770828 (ECHS1)
   00071 Fatty acid degradation
    770828 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    770828 (ECHS1)
   00310 Lysine degradation
    770828 (ECHS1)
   00380 Tryptophan metabolism
    770828 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    770828 (ECHS1)
Enzymes [BR:gga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     770828 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 301 aa AA seqDB search
MAASLRALLRPSAGACADAARRRAFLAALRPLVAGRGCSDGPPFRFLQVQKAGAGGSVGL
IRLQRPEALNALCAGLMEELRRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQ
ECYAGGFLAGWDRVATVRKPTIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
IPGAGGTQRLTRAVGKSLAMEMVLTGERISAAEAKAAGLVSKVFPVDKLLDAAIGCAEKI
AANSKLVVAMAKESVNAAFETTLTEGNRTEKRLFYATFATDDRKEGMTAFVEKRKANFTD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgttgcgcgccctcctccgtcccagcgccggtgcctgcgccgatgccgcg
cggcgccgcgcgttcctggcggcactccgcccccttgtggcggggcgggggtgcagcgac
ggtcccccgttccgcttcctccaggtgcagaaggccggggcgggcggcagcgtggggctg
atccggctgcagcggcccgaggcgctcaacgcgctctgtgcggggctgatggaggagctg
agacgcgcactggacgccttcgaggccgacgggcaggtgggagctattgtcatcaccggc
agtgagaaggcctttgcagccggcgctgacattaaagagatgcagaacaaaaccttccag
gagtgctatgctggcggcttcctggccggctgggaccgggtggccactgtccgcaagccc
accatcgccgctgttaatggcttcgctttgggcggcggctgtgaactggccatgatgtgc
gacatcatctatgccggggagaaggcgcagtttggacagcccgagatcctgctggggaca
atcccaggtgccggcgggacgcagaggctgaccagggcggtgggcaagtcgctggccatg
gagatggtgctgaccggggagcggatctcggcggcggaggccaaagcggcaggtctggtc
agcaaagtcttccccgtggacaagctgctggacgcggccattggctgcgctgagaagatc
gctgccaactccaagctggtggtagctatggccaaggagtccgtcaatgctgctttcgaa
acaacactgacagaggggaacaggacggagaagcgcctcttctatgccacttttgccacc
gacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggccaacttcactgac
agttga

DBGET integrated database retrieval system