KEGG   Gallus gallus (chicken): 770905Help
Entry
770905            CDS       T01006                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    770905 (PTPN7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     770905 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
26
AA seq 364 aa AA seqDB search
MVQACSVCHRAHNSSLTARVATKAMDKADKPSPSAKKHVRLQERRGSNVSLVLDMSSLGS
VEPIQPVCTPRDITLQFLRTSSHVLRTEELQQRAQSLAQLQEEFSKIPPNFISPEELEIP
GHASKDRYKTILPNPESRVCLRRAGSQEEDGYINANYITGYAGRPREYIATQGPMLNTVT
DFWEMVWQEEAPIIVMITKLQERKEKCVHYWPEKEGTYGPFTIRVQGISEYAEYVVRSLS
IQLEGECRHVKHILFPSWPDQQTPESAKPLLHLVSKVEETLQAAASPGPIIVHCSAGIGR
TGCFIATRIGCQQLKDKGDVDILGIVCRLRIDRLVLGQAALKDAAGCRRDAGGCRDEHPK
EAWS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtccaagcctgctcagtgtgccacagagctcataacagcagcctgacagcccgggtg
gccaccaaagccatggacaaggcagacaagcccagtccctctgcgaagaagcacgtgcgg
ctccaggagaggaggggctccaacgtgtcgctggtgctggacatgagctcgctgggcagt
gtggagcccatccagcccgtatgcacaccgcgggacatcacgctgcagttcctaaggaca
tccagccatgtgctgaggacggaggagctgcagcagcgtgcccagagcctggcacagctc
caggaggagttctcgaaaatcccacccaacttcatcagtccggaggagctggagatccct
ggacacgcctccaaggacagatacaaaaccatcctccccaatcctgagagccgggtgtgc
ctcagaagggcagggagtcaggaggaggacggctacatcaatgccaactacatcacgggc
tatgcaggacgtccccgggagtacattgccacccaggggcccatgctgaacaccgtgact
gatttctgggagatggtgtggcaggaggaagcacccatcatcgtcatgataaccaagctc
caggagcgcaaggagaaatgtgtccactattggcctgagaaggagggcacctacggcccc
ttcaccatccgtgtgcaggggattagcgagtatgcggagtacgtggtccgcagtctgtcc
atccagctggaaggtgaatgccgccacgtcaaacacatcctcttcccttcctggccagac
cagcagacacctgagtcagccaagcccctgctgcacctggtgtccaaagtggaggagact
ctgcaggctgcagccagcccagggcccatcattgtgcactgcagtgcaggcattggtcgg
acgggctgcttcatcgctaccaggattgggtgccagcagctgaaggacaaaggagatgtg
gacatcctgggaatcgtgtgccgcctccgcatagacaggttggtgctcgggcaggcggcc
ctgaaggatgctgctggatgcaggagggacgcgggagggtgcagggatgagcatcccaag
gaggcatggagctga

DBGET integrated database retrieval system