KEGG   Gallus gallus (chicken): 770919Help
Entry
770919            CDS       T01006                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
gga  Gallus gallus (chicken)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    770919
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    770919
   04115 p53 signaling pathway
    770919
 Human Diseases
  Infectious diseases
   05164 Influenza A
    770919
   05168 Herpes simplex infection
    770919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
7
AA seq 455 aa AA seqDB search
MVVQEYEEHSLDLLTFNSKFFRKGFINAYLLSYTIYFVKCLSTILKLIRIVFRHCISPKP
AAALTTPGEPRPKAVPGQLSGPTPGAALPHRLGSCGSPATPGWTRAERAARRLRPDPAQP
YLDRLGVRDQAAAVHLLHGPAGLRAASKLDEGDASGLVGALVAQQPDVLDVPERGEALPN
QRLARVLAQHHENAAVGRLVQALGRQPESAALLHGGAAARLAGRSGALALLGAGRRATTG
LLPPGRQHGRATSPRGPLGRRTEPTTSGSPPERRTQCLVPPLGSATRQSEEKARRGGLRD
WAPLQDTCPAGGAEGRARRDPGGTGCSEWRGVGSPRLCRQLLIKMGDVEKGKKIFIQKCS
QCHTVEKGGKHKTGPNLWGLFGHRTGQAAGFPYSEANKKKGKANMTRVTWSESTLMEYLE
NPKKYIPGTKMIFAGIKKQNERADLIAYLKKATSL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgcaagaatatgaggagcacagcttggatctcctgacttttaacagcaagttc
ttcaggaaaggctttattaatgcttatctactatcttatactatctactttgttaaatgc
ttatctactatcctgaaacttatcaggatagttttcaggcactgcatttcccccaagccc
gcagcagctctcacgaccccgggggaacccaggccaaaggcagtacccgggcagctctca
gggccgacgcccggcgcggcccttccccaccgcctcgggagctgcggctctcccgccacg
ccgggatggacgcgggccgagagggcggcccgacggctccggcccgacccagcgcagccg
taccttgataggcttggtgtccgggaccaggctgcggccgtgcatctcctccatggcccg
gcaggcttgcgagctgcgagcaaacttgatgaaggcgatgcctcgggactcgttggtgcg
cttgtcgcgcagcagccagatgttctggatgtccccgaacggggcgaagcgctcccgaat
cagcgcctcgcccgcgtccttgcccagcaccacgaaaacgcggctgttgggcggctcgtc
caggcactcggccgacagccggaatccgctgctctcctccatggcggagccgccgctcgg
ctcgcgggccgtagtggagcgctggctctgctcggggccgggcgaagagctaccaccggc
ctccttccgccggggagacaacatggccgcgccacgtccccgcgcggaccgctgggacgg
cgcacggagcccaccacctccggctcccccccggaaaggaggacgcagtgcttagtcccg
cccctcggatctgccacacgccaatcagaagagaaggcgcgaagaggaggtctccgcgat
tgggcgcctcttcaggacacctgccccgcaggcggggctgagggccgcgcgaggagggac
ccaggcgggacggggtgcagcgagtggcggggtgttggttcgcctcgcttgtgccgccag
ctcttgatcaaaatgggtgatgttgaaaaaggcaagaagatctttattcagaaatgttct
cagtgtcatacagttgaaaaaggtggaaagcacaagacaggaccaaatctttggggttta
tttggccacagaacaggacaagctgcaggatttccctactcagaggcaaacaagaagaaa
ggaaaagctaacatgacacgggttacctggagtgagagcacactgatggagtatttggaa
aaccctaagaaatacattcctggtacaaaaatgatttttgctggaattaaaaagcagaat
gaaagagctgatcttattgcatacttgaaaaaagcaacttctttgtga

DBGET integrated database retrieval system