KEGG   Gallus gallus (chicken): 770994Help
Entry
770994            CDS       T01006                                 

Gene name
HEXDCL, HEXDC
Definition
(RefSeq) hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing-like
  KO
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
gga  Gallus gallus (chicken)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    770994 (HEXDCL)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     770994 (HEXDCL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
14
AA seq 560 aa AA seqDB search
MAFQRSHKLNLLRIVVLLLVALAGIKFLFRDSLTLQLHKHISKDSTFWGDAGDSGPQSQA
VEVHPAKITAPRQGPKQQFPKDLSATEMRLVHLDLKGAAPRVSYLEQLFPFLSRLGANGI
LIEYEDMFPFKGELEVLKSPYAYSEEDIEWIQQLAELHKLEVVPLVQTFGHVEFILKHTK
YQHLREVERFPNSFNPHVPDTLALLKVMLSQVMEKHRRSSWIHIGADEVFHLGEGKDSRN
WMSRNKGDTGTIYLNHIKEVLDFISTQYRGLRVLMWDDMLRKISVGALQESGIAKHVSPV
VWFYAPDFDAEQIGQFITKYMESGFEAVWFASAFKGTTGPTQTWPPLSSHLKNQLSWLRV
REAMPRFAPLRFQGIVLTGWQRYDHYSVLCELLPVGIPSLAICLQTLVNGGFTEETRRKV
LEVLGFQSMQLEQSTCEGRGAFPGAEIYHMVEQLNRHLKESITKMLEEESAIKGWFSPYH
RKHQFGNPRNMESFGSKVLKLHEDWEGFVRDLRARLESIYFPDTVEEWMEENVNPHLDPL
RDLVRDYRAIIRLNAQPKAP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggccttccagcggagccacaagctgaacctgctgcgtattgttgtgttgctcctcgtg
gccttggccggcatcaagttcctcttccgtgacagcttaacccttcagctgcacaagcac
atcagcaaggacagcacgttctggggagatgcaggggactctggcccccaaagccaggct
gtggaggtccaccctgcaaagatcacggccccgaggcagggacctaagcagcagttcccc
aaggacctcagtgccactgagatgaggctcgttcacctggacctgaagggagctgctccc
agggtctcctacctggagcagctgttcccattcctgtcccggctgggagccaacgggatc
ctgattgagtacgaggatatgttccccttcaagggggagctggaagtcctcaagtccccc
tacgcttacagtgaggaggacattgagtggatccagcagctggcagagctccacaagctg
gaggtggttcccttggtgcagacctttggtcacgtggagttcatcctcaaacacaccaaa
taccagcacctgcgggaggtggagcgcttccccaacagcttcaacccccatgtcccggac
accctggcattgctcaaggtcatgctatcgcaggtgatggagaaacacaggcgctcttcg
tggatccacattggtgcagatgaggtcttccaccttggggagggaaaggactccaggaat
tggatgagccgcaacaagggtgacacggggaccatatacctgaaccacatcaaggaggtg
ctggacttcatctccacgcagtaccggggactgcgggtgctcatgtgggacgacatgctg
aggaagatcagtgtgggagccctgcaggagtctgggatagcaaagcatgtctcacccgtt
gtgtggttctatgcacctgactttgacgcagagcagattgggcagttcatcaccaagtac
atggagagtggcttcgaggccgtgtggtttgccagcgccttcaagggcaccacgggccca
acacagacatggcccccactcagctcccacctgaagaaccagctcagctggctgcgggtg
cgtgaggccatgccgcgcttcgccccgctgcgcttccagggcattgtcctcactggatgg
cagaggtacgaccactactcagtgctgtgcgagctgctgcccgtcggcattccctccctg
gccatatgcctccagaccctggtgaacgggggattcacggaagagacgcggaggaaggtg
ctggaggtgttgggcttccagagcatgcagctggagcagagcacatgtgagggaagggga
gcgttccctggggcagaaatctatcacatggtggagcagctgaacagacacctgaaggag
agcatcaccaaaatgctggaggaagaaagtgccatcaagggctggttcagcccctaccac
cgcaagcaccagtttggcaaccctcgcaacatggagagcttcggcagcaaggtgctcaag
ctccatgaggactgggagggctttgtccgggacctgcgtgcccgcctggagagtatctac
ttccctgacacagtggaggagtggatggaggagaatgtcaaccctcacctggaccctctg
cgggacctggtccgggactaccgtgccatcatccgcctcaacgcccagcccaaggcacct
tag

DBGET integrated database retrieval system