KEGG   Gallus gallus (chicken): 771145Help
Entry
771145            CDS       T01006                                 

Gene name
MAPK13
Definition
mitogen-activated protein kinase 13
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:gga04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:gga04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:gga04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:gga04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:gga04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:gga04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:gga05132]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
26
AA seq 365 aa AA seqDB search
MNFTRRRGFYRQELNRTIWELPRRYTSLHPVGSGAYGSVCSAIDKKTGEKVAIKKLCRPF
QSEIFAKRAYRELTLLKQMQHENVIGLLDVFTSAPSYHGFQDFYLVMPYMRTDLQKIMGH
EFSDEKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNEDCQLKILDFGLARHADAEMT
GYVVTRWYRAPEVILNWMHYNQTVDIWSIGCIMAEMLTGKTLFKGKDYVDQLTQILKVTG
HPGDDFVEKLEDKAAKSYIKSLPKMPKKDLSVLFPTANPQAVDLLDKMLQLDVEKRLTAT
EALAHPYFDQFRDIEEETEAQQSYDDSLEREKLSIEEWKKHIYKEILSFSPIAQKDSKKR
SGMSL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcacaaggagaagaggcttttacagacaggagctgaacagaaccatctgggag
ctgcccaggaggtacacctccctgcaccccgtgggctctggggcctacggttccgtctgc
tccgccatagacaagaagacaggagagaaagtggccatcaagaagctgtgccgcccattc
cagtcggagatctttgccaagagagcgtacagagagctcacgctcttgaagcaaatgcag
catgagaatgtcattgggctgcttgatgtcttcacctccgccccttcctaccacggattc
caggacttctacctggtgatgccatacatgcggacagatttacaaaagatcatgggacat
gaattcagtgatgaaaagatccagtacctggtctaccagatgctgaaagggctgaagtat
attcattctgccggaatcatccacagggacctgaagccaggcaacctggctgtgaatgaa
gactgccagctaaagatcttggactttggcttggcaagacatgctgatgctgaaatgaca
ggctatgtggtcacgcgctggtatagagctccagaagtcattctgaactggatgcattac
aaccagacagtggatatctggtctattggttgcatcatggcagaaatgctgactggaaaa
acgctgtttaaaggaaaagactacgttgatcagctgactcagatcctgaaagtaacaggg
catcccggagatgactttgtggagaagcttgaggacaaggcggctaaaagttatatcaag
tctcttccaaaaatgcccaagaaggatttgtctgtgctcttccccacagccaatcctcag
gcagtggacctgctggacaagatgctgcagctggatgtggagaagcgccttacggccaca
gaagcattagcccacccatactttgatcaattccgagacattgaggaggagacagaggca
caacagtcctacgatgattctctggagcgtgaaaagctttcaatagaagaatggaaaaaa
catatctacaaggagatcttatccttcagtccaattgcacagaaggactcaaagaagcga
agtggaatgtcgctgtag

DBGET integrated database retrieval system