KEGG   Gallus gallus (chicken): 771904Help
Entry
771904            CDS       T01006                                 

Gene name
PFN2, profilin-2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
gga  Gallus gallus (chicken)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    771904 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    771904 (PFN2)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   771904 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc
gccattgtgggctactgcgacgccaaatacgtctgggcggccacggccggcggcatcttc
cagagcatcacgccagtagaaatagatatgattgtagggaaggatcgggagggtttcttc
accaatggcctgaccctcggtgcaaagaagtgctctgtgatcagagacagcctctacgtg
gatggggactgcacaatggacatccggacgaagagccaaggcggggagccgacgtacaat
gtggccgtaggcagagctgggcgagtcttggtctttgtaatgggcaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system