KEGG   Gallus gallus (chicken): 771904Help
Entry
771904            CDS       T01006                                 

Gene name
PFN2, profilin-2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
gga  Gallus gallus (chicken)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:gga04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:gga05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
9
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc
gccattgtgggctactgcgacgccaaatacgtctgggcggccacggccggcggcatcttc
cagagcatcacgccagtagaaatagatatgattgtagggaaggatcgggagggtttcttc
accaatggcctgaccctcggtgcaaagaagtgctctgtgatcagagacagcctctacgtg
gatggggactgcacaatggacatccggacgaagagccaaggcggggagccgacgtacaat
gtggccgtaggcagagctgggcgagtcttggtctttgtaatgggcaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system