KEGG   Gallus gallus (chicken): 771916Help
Entry
771916            CDS       T01006                                 

Gene name
PLB1
Definition
phospholipase B1
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    771916 (PLB1)
   00565 Ether lipid metabolism
    771916 (PLB1)
   00590 Arachidonic acid metabolism
    771916 (PLB1)
   00591 Linoleic acid metabolism
    771916 (PLB1)
   00592 alpha-Linolenic acid metabolism
    771916 (PLB1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     771916 (PLB1)
    3.1.1.5  lysophospholipase
     771916 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
3
AA seq 995 aa AA seqDB search
MKIYSKALISSFNPSVLHQSPLPGTMGAASDGQTTSLLDQAGEIVKLMKENQMMDFQNDW
KLITVFFSAENPCSSCASTQPKNCILDNLEKLQEVLDFLYKEVPKAFVNLVDSTEMTTSF
LMCHDPQNASNSTGNQCNCIHKHSMLNYNILRWSYQDAWEKLLKSKRYDQKDNFTVVLQP
SLQETNLLLSLSRDGFFSTSKTQVETLEEDYTFMALSLWKNMLEPVGQKKPYDFTELHQV
QCPSQENPYLFTYRNSNYSLFQEISNTKETLQERSYGTNVPCFNQGPSDTVPDSVHKLRP
ADIRVIAALGDSITAGNGAASNPHDVLDVLTQYRGISWSVGGNENISTVTTLANILREFN
PSLIGYSTGTGTQTTENAALNQAVAGAQAEDVPAQVRRLVDRMMNDSRINMQSDWKLITL
FIGGNDLCKFCEDPIRYSPENYTYNIQVALDMLHKEVPRAFVNLVTILSITSLRELYAEK
NVSCPRLLMRILCPCVLDYDENSSEYKQLIYFNKRYQERTRELVESGRYDTREDFTVVVQ
PFLTHISMPKTQEGFPDNSYFAPDCFHFSQKSHSQAARGLWNNMVEPVGKKTDDQQMENE
IVLKCPSEAEPFLRTYKNSNYTYPNQTPNYGSQLLCEDRSPSSPSPTSVHSLKPADVNII
AALGDSLTAGTGIASYSLMDLATQFRGLSWSIGGDDSLENVTTLPNIFREFNAKIEGYST
GTGSENDPNAFLNQAVPGAQAEHLPAQARALLKLMKTDSRIDFSADWKIITVHIGGNDLC
NYCKDPDHYSAVNFTSRIQETLDILHEQVPRALVSLVGVMDILHMRQIFVDTEVQCPTYM
SDYLCSCVLTGEENSENLTMVREATKAYQLGIQRLVESGRYDTHDNFTVVIQTSFQNPKI
PLDQDGHPDISYFAPDCFHPSQKGHSQLAKALWNAMLQPVGQKSDSFDFTADIVLSCPTQ
NNSFLSTNKNSNNANPPVLPTSEPTEVTVASFAAF
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttactccaaagctcttattagcagttttaatccctcggtcctgcaccagtct
cctctgcctggcacaatgggagcagcatcagatggtcaaacaacaagcctcttggatcaa
gctggagaaatagtgaagctcatgaaagagaaccagatgatggacttccaaaatgattgg
aaactgatcacagttttctttagtgctgaaaacccatgctcttcttgtgcttccacacaa
ccgaagaactgcatattggacaacctggaaaaacttcaagaagtcttggactttttatat
aaagaagttcccaaagcctttgtaaatttggtagattccactgagatgacaacttccttt
ctcatgtgccacgatcctcaaaatgccagcaattcaactgggaatcagtgcaattgcatt
cacaaacactctatgctaaattataacattctgaggtggtcctatcaggatgcttgggaa
aaacttctcaagtctaagaggtacgatcaaaaggataatttcactgtcgttcttcagcct
tccctccaagaaacaaatcttttgctcagtctgagcagggatggtttcttcagcacatca
aagacccaagtggaaactctggaagaggattatactttcatggctttgagcctctggaag
aacatgttggaaccagttgggcagaagaagccatacgatttcacagaattgcatcaggtc
cagtgtccatctcaggaaaatccatatttgttcacttaccgaaatagtaactactcactt
ttccaagagatatcaaacactaaagaaacactgcaggagagaagttatggaacaaatgtt
ccttgtttcaaccagggtccttctgatacagttccagattcagttcataagttgagacca
gcagatattcgagtgattgctgccctgggagattcaatcacagcaggtaatggggcagca
tccaatccccatgatgttctggatgtcctgactcagtaccgaggtatttcttggagtgtt
ggaggaaatgaaaacataagcacggtcacaacactagcaaacattcttcgtgagttcaac
ccatccctgataggatattccactggcactggaacacaaactacagaaaatgctgcactc
aaccaagcagttgcaggggctcaggcagaggatgttcctgcacaagtcagaagactggtg
gaccgaatgatgaatgacagtagaataaatatgcagtctgactggaagcttataacgctt
ttcataggaggaaacgacctatgtaaattctgcgaagatcctatacgctattctcctgaa
aactacacctataatattcaagtagctttggacatgcttcacaaagaggttccacgggca
tttgtgaatctggtgacaatcctttccataacaagcctacgggagttgtatgcagagaaa
aatgtttcctgtccaaggcttcttatgaggatattgtgcccctgtgtattggactatgat
gaaaattccagtgagtataagcagttgatctacttcaacaaaagatatcaggagaggacc
cgtgagttagtggagagcggaagatatgacactagggaagattttacggtggtcgtgcag
ccttttctgactcatatcagcatgcccaaaacacaggagggatttcctgacaattcatac
tttgccccagactgttttcacttcagccagaagtctcattcgcaggctgcacgtggtctg
tggaacaacatggtggaacctgtggggaagaagacggatgaccaacaaatggaaaatgaa
attgtcctcaaatgtccaagtgaggctgagccgttcctgaggacgtacaaaaacagtaat
tacacgtaccctaaccaaactccaaattatggaagccagctgctatgtgaggacaggtct
ccatcctccccttctccaacttcagtgcattccctaaagccagctgatgtgaatattata
gcagcccttggggattctttgacggctggtacgggaattgcctcatacagtctcatggat
ttggctactcaattccgtggattgtcatggagtattggaggggatgactcattagagaac
gtaacaactctgcctaatatctttcgagagttcaatgctaagatcgagggctattcaact
ggcacagggagcgagaatgacccaaacgcattccttaaccaggcggttccaggagcacag
gctgagcacttaccagcccaagcaagagctctcctgaaactaatgaaaactgattctaga
attgacttcagtgctgactggaaaatcataacagtgcatattggaggcaatgatctatgc
aactattgcaaagaccctgatcattactcagctgtaaatttcaccagtagaattcaagaa
actcttgatattctgcatgagcaggtaccaagagctctagtgagtttagtcggagtaatg
gacatcctccatatgagacagatttttgtggatactgaagttcagtgccccacttacatg
tcagattatctgtgtagttgtgttctcacaggagaagaaaactcagaaaacttaacaatg
gtgagggaggccactaaagcttaccagcttggtattcaaaggctggtggagtctggcaga
tatgacactcatgacaatttcacagtggtcatccagacttccttccaaaatcccaagatt
cctcttgatcaggatgggcatcctgatatctcctactttgcacctgactgcttccatcca
agccagaagggccattctcagcttgccaaggctctctggaatgctatgttgcagcctgta
ggccagaaatctgactcatttgacttcacggctgacattgtcctcagctgcccgactcag
aacaactccttcctgagtacaaataaaaatagcaacaacgcgaatcctcctgtgcttccc
accagtgagccaacagaggtaactgttgcttcttttgctgcattttag

DBGET integrated database retrieval system