KEGG   Gallus gallus (chicken): 771916Help
Entry
771916            CDS       T01006                                 

Gene name
PLB1
Definition
phospholipase B1
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gga00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:gga00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gga00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:gga00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:gga00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
3
AA seq 995 aa AA seqDB search
MKIYSKALISSFNPSVLHQSPLPGTMGAASDGQTTSLLDQAGEIVKLMKENQMMDFQNDW
KLITVFFSAENPCSSCASTQPKNCILDNLEKLQEVLDFLYKEVPKAFVNLVDSTEMTTSF
LMCHDPQNASNSTGNQCNCIHKHSMLNYNILRWSYQDAWEKLLKSKRYDQKDNFTVVLQP
SLQETNLLLSLSRDGFFSTSKTQVETLEEDYTFMALSLWKNMLEPVGQKKPYDFTELHQV
QCPSQENPYLFTYRNSNYSLFQEISNTKETLQERSYGTNVPCFNQGPSDTVPDSVHKLRP
ADIRVIAALGDSITAGNGAASNPHDVLDVLTQYRGISWSVGGNENISTVTTLANILREFN
PSLIGYSTGTGTQTTENAALNQAVAGAQAEDVPAQVRRLVDRMMNDSRINMQSDWKLITL
FIGGNDLCKFCEDPIRYSPENYTYNIQVALDMLHKEVPRAFVNLVTILSITSLRELYAEK
NVSCPRLLMRILCPCVLDYDENSSEYKQLIYFNKRYQERTRELVESGRYDTREDFTVVVQ
PFLTHISMPKTQEGFPDNSYFAPDCFHFSQKSHSQAARGLWNNMVEPVGKKTDDQQMENE
IVLKCPSEAEPFLRTYKNSNYTYPNQTPNYGSQLLCEDRSPSSPSPTSVHSLKPADVNII
AALGDSLTAGTGIASYSLMDLATQFRGLSWSIGGDDSLENVTTLPNIFREFNAKIEGYST
GTGSENDPNAFLNQAVPGAQAEHLPAQARALLKLMKTDSRIDFSADWKIITVHIGGNDLC
NYCKDPDHYSAVNFTSRIQETLDILHEQVPRALVSLVGVMDILHMRQIFVDTEVQCPTYM
SDYLCSCVLTGEENSENLTMVREATKAYQLGIQRLVESGRYDTHDNFTVVIQTSFQNPKI
PLDQDGHPDISYFAPDCFHPSQKGHSQLAKALWNAMLQPVGQKSDSFDFTADIVLSCPTQ
NNSFLSTNKNSNNANPPVLPTSEPTEVTVASFAAF
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttactccaaagctcttattagcagttttaatccctcggtcctgcaccagtct
cctctgcctggcacaatgggagcagcatcagatggtcaaacaacaagcctcttggatcaa
gctggagaaatagtgaagctcatgaaagagaaccagatgatggacttccaaaatgattgg
aaactgatcacagttttctttagtgctgaaaacccatgctcttcttgtgcttccacacaa
ccgaagaactgcatattggacaacctggaaaaacttcaagaagtcttggactttttatat
aaagaagttcccaaagcctttgtaaatttggtagattccactgagatgacaacttccttt
ctcatgtgccacgatcctcaaaatgccagcaattcaactgggaatcagtgcaattgcatt
cacaaacactctatgctaaattataacattctgaggtggtcctatcaggatgcttgggaa
aaacttctcaagtctaagaggtacgatcaaaaggataatttcactgtcgttcttcagcct
tccctccaagaaacaaatcttttgctcagtctgagcagggatggtttcttcagcacatca
aagacccaagtggaaactctggaagaggattatactttcatggctttgagcctctggaag
aacatgttggaaccagttgggcagaagaagccatacgatttcacagaattgcatcaggtc
cagtgtccatctcaggaaaatccatatttgttcacttaccgaaatagtaactactcactt
ttccaagagatatcaaacactaaagaaacactgcaggagagaagttatggaacaaatgtt
ccttgtttcaaccagggtccttctgatacagttccagattcagttcataagttgagacca
gcagatattcgagtgattgctgccctgggagattcaatcacagcaggtaatggggcagca
tccaatccccatgatgttctggatgtcctgactcagtaccgaggtatttcttggagtgtt
ggaggaaatgaaaacataagcacggtcacaacactagcaaacattcttcgtgagttcaac
ccatccctgataggatattccactggcactggaacacaaactacagaaaatgctgcactc
aaccaagcagttgcaggggctcaggcagaggatgttcctgcacaagtcagaagactggtg
gaccgaatgatgaatgacagtagaataaatatgcagtctgactggaagcttataacgctt
ttcataggaggaaacgacctatgtaaattctgcgaagatcctatacgctattctcctgaa
aactacacctataatattcaagtagctttggacatgcttcacaaagaggttccacgggca
tttgtgaatctggtgacaatcctttccataacaagcctacgggagttgtatgcagagaaa
aatgtttcctgtccaaggcttcttatgaggatattgtgcccctgtgtattggactatgat
gaaaattccagtgagtataagcagttgatctacttcaacaaaagatatcaggagaggacc
cgtgagttagtggagagcggaagatatgacactagggaagattttacggtggtcgtgcag
ccttttctgactcatatcagcatgcccaaaacacaggagggatttcctgacaattcatac
tttgccccagactgttttcacttcagccagaagtctcattcgcaggctgcacgtggtctg
tggaacaacatggtggaacctgtggggaagaagacggatgaccaacaaatggaaaatgaa
attgtcctcaaatgtccaagtgaggctgagccgttcctgaggacgtacaaaaacagtaat
tacacgtaccctaaccaaactccaaattatggaagccagctgctatgtgaggacaggtct
ccatcctccccttctccaacttcagtgcattccctaaagccagctgatgtgaatattata
gcagcccttggggattctttgacggctggtacgggaattgcctcatacagtctcatggat
ttggctactcaattccgtggattgtcatggagtattggaggggatgactcattagagaac
gtaacaactctgcctaatatctttcgagagttcaatgctaagatcgagggctattcaact
ggcacagggagcgagaatgacccaaacgcattccttaaccaggcggttccaggagcacag
gctgagcacttaccagcccaagcaagagctctcctgaaactaatgaaaactgattctaga
attgacttcagtgctgactggaaaatcataacagtgcatattggaggcaatgatctatgc
aactattgcaaagaccctgatcattactcagctgtaaatttcaccagtagaattcaagaa
actcttgatattctgcatgagcaggtaccaagagctctagtgagtttagtcggagtaatg
gacatcctccatatgagacagatttttgtggatactgaagttcagtgccccacttacatg
tcagattatctgtgtagttgtgttctcacaggagaagaaaactcagaaaacttaacaatg
gtgagggaggccactaaagcttaccagcttggtattcaaaggctggtggagtctggcaga
tatgacactcatgacaatttcacagtggtcatccagacttccttccaaaatcccaagatt
cctcttgatcaggatgggcatcctgatatctcctactttgcacctgactgcttccatcca
agccagaagggccattctcagcttgccaaggctctctggaatgctatgttgcagcctgta
ggccagaaatctgactcatttgacttcacggctgacattgtcctcagctgcccgactcag
aacaactccttcctgagtacaaataaaaatagcaacaacgcgaatcctcctgtgcttccc
accagtgagccaacagaggtaactgttgcttcttttgctgcattttag

DBGET integrated database retrieval system