KEGG   Gallus gallus (chicken): 771920Help
Entry
771920            CDS       T01006                                 

Gene name
ADH1C, ADH-1, ADH1, ADH1B
Definition
(RefSeq) alcohol dehydrogenase 1C (class I), gamma polypeptide (EC:1.1.1.1)
  KO
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    771920 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    771920 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    771920 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    771920 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    771920 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    771920 (ADH1C)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     771920 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
4
AA seq 376 aa AA seqDB search
MSTVGKVIKCKAAVLWEANKPFSLEEVEVAPPKAHEVRIKIVATGICRSDDHVVTGALAM
PFPIILGHEAAGVIESVGEKVTSLKPGDAVIPLFVPQCGECRSCLSTKGNLCIKNDLSSS
PTGLMADGTTRFTCKGKAIHHFVGTSTFTEYTVVHETAAAKIDSAAPLEKVCLIGCGFST
GYGAVLQTAKVEAGSTCAVFGLGGVGLSVVMGCKAAGASRIIAVDINKDKFAKAKELGAT
ECINPKDFKKPIHEVLTEMTGQGVDYSFEVIGRIETMTAALASCHNNYGVSVIVGVPPAA
QKISFDPMLIFSGRTWKGSVFGGWKSKDAVPKLVADYMKKKFVLDPLITHTLPFTKINEG
FDLLRTGKSIRSVLVL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtgggcaaagttattaaatgcaaggcagcagtactgtgggaagcgaataaa
ccattttctcttgaggaagtggaagttgccccaccaaaagcacatgaagttcgtattaag
attgtagccacggggatctgtcgctctgatgaccacgtggtgactggtgcactggctatg
ccttttccaataatccttgggcacgaggcagctggtgtcatagaaagtgttggggagaaa
gtaacttcgttaaagccaggagacgcagttattccactctttgttccacagtgtggagag
tgcagatcttgcttaagcaccaagggtaatttgtgcattaaaaatgatctttcttcttca
cctactggactaatggctgatggtaccactaggtttacctgtaaggggaaagcaattcat
cattttgttggtacaagtactttcactgaatacacggtagtacacgaaactgctgcagcc
aaaatagattctgctgctcctctggaaaaagtttgtctgattggctgtggattctcaact
ggttatggggctgttctgcagactgccaaggtagaagcaggctccacctgtgccgtcttt
ggccttggaggagtcggcctctctgttgtcatgggctgcaaggcagctggagcgtcccgc
atcattgccgtcgatatcaacaaggacaagtttgccaaggccaaggagctaggagccacc
gagtgcatcaaccctaaagatttcaagaagcctattcatgaagtgctgactgaaatgact
ggccagggtgtggactactccttcgaggtcatcggccgtattgaaaccatgactgcggcc
ttggcctcttgccacaacaactacggagtcagcgtgattgtgggagtgcctcctgcagca
caaaaaattagttttgaccccatgcttatcttcagtggtcgcacctggaaagggtccgtc
tttggaggctggaagagtaaagacgccgtgcccaaactggttgctgattacatgaagaaa
aagtttgttttggatccattaataacccacacacttcctttcactaaaatcaatgaggga
tttgatctgctaaggacagggaagagtattcgcagcgtcctcgtattgtaa

DBGET integrated database retrieval system