KEGG   Gallus gallus (chicken): 771920Help
Entry
771920            CDS       T01006                                 

Gene name
ADH1C, ADH-1, ADH1, ADH1B
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gga00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gga00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gga00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:gga00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:gga00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:gga00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
4
AA seq 435 aa AA seqDB search
MCKGWDYELSSLAKCWSYVLAEALCKSSCQGTGRGLCISSLTRHKKPVGARFKTDVPANM
STVGKVIKCKAAVLWEANKPFSLEEVEVAPPKAHEVRIKIVATGICRSDDHVVTGALAMP
FPIILGHEAAGVIESVGEKVTSLKPGDAVIPLFVPQCGECRSCLSTKGNLCIKNDLSSSP
TGLMADGTTRFTCKGKAIHHFVGTSTFTEYTVVHETAAAKIDSAAPLEKVCLIGCGFSTG
YGAVLQTAKVEAGSTCAVFGLGGVGLSVVMGCKAAGASRIIAIDINKDKFAKAKELGATE
CINPKDFKKPIHEVLTEMTGQGVDYSFEVIGRIETMTAALASCHNNYGVSVIVGVPPAAQ
KISFDPMLIFSGRTWKGSVFGGWKSKDAVPKLVADYMKKKFVLDPLITHTLPFTKINEGF
DLLRTGKSIRSVLVL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaggggtgggactacgagctcagcagcttggctaaatgttggagctatgtgctt
gcagaagcactttgtaagagcagctgccagggcactggacgaggactgtgtatcagcagc
ttgactcggcacaagaaacctgtgggagcaagattcaaaacagacgtgccggccaacatg
agcacagtgggcaaagttattaaatgcaaggcagcagtactgtgggaagcgaataaacca
ttttctcttgaggaagtggaagttgccccaccaaaagcacatgaagttcgtattaagatt
gtagccacggggatctgtcgctctgatgaccatgtggtgactggtgcactggctatgcct
tttccaataatccttgggcacgaggcagctggtgtcatagaaagtgttggggagaaagta
acttcgttaaagccaggagacgcagttattccactctttgttccacagtgtggagagtgc
agatcttgcttaagcaccaagggtaatttgtgcattaaaaatgatctttcttcttcacct
actggactaatggctgatggtaccactaggtttacctgtaaggggaaagcaattcatcat
tttgttggtacaagtactttcactgaatacacggtagtacacgaaactgctgcagccaaa
atagattctgctgctcctctggaaaaagtttgtctgattggctgtggattctcaactggt
tatggggctgttctgcagactgccaaggtagaagcaggctccacctgtgccgtctttggc
cttggaggagtcggcctctctgttgtcatgggctgcaaggcagctggagcgtcccgcatc
attgccattgatatcaacaaggacaagtttgccaaggccaaggagctaggagccaccgag
tgcatcaaccctaaagatttcaagaagcctattcatgaagtgctgactgaaatgactggc
cagggtgtggactactccttcgaggtcatcggccgtattgaaaccatgactgcggccttg
gcctcttgccacaacaactacggagtcagcgtgattgtgggagtgcctcctgcagcacaa
aaaattagttttgaccccatgcttatcttcagtggtcgcacctggaaagggtccgtcttt
ggaggctggaagagtaaagacgccgtgcccaaactggttgctgattacatgaagaaaaag
tttgttttggatccattaataacccacacacttcctttcactaaaatcaatgagggattt
gatctgctaaggacagggaagagtattcgcagcgtcctcgtattgtaa

DBGET integrated database retrieval system