KEGG   Gallus gallus (chicken): 771974Help
Entry
771974            CDS       T01006                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     771974
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP4 family
   771974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 507 aa AA seqDB search
MKATWFGVDVARVLHLAAVFCLTCVLLKAIQLYHRRRELLRALSAFPGHPTHWLLGHVQE
FLKEEDVLEKAEAWALKYQHAHPIWFGGFSAVLVINDPEYAKALFARGDPKDNLSYKHLI
PWIGNGLLILHGPKWHQHRKLLTPGFHYDVLKPYVALMAESTNVMLDKWEKLITNGKSVE
LFEHVSLMTLDSIMKCAFSYHSNCQTDRQNTYIQAVYDLCRMVHERLRIFPYHNDFIYWL
SPHGYQFRKVCQLAHDHTDKVIQERKESLKDEREFEKIKKKRHLDFLDILLCAKDETGAG
LSDEDLRAEVDTFMFEGHDTTASGLSWVLYCLASHPEHQARCREEIKDILGSRDTIQWED
LGKMTYSTMCIKESLRLYPPVPGVSRQLSKPITFHDGRTLPEGTITAISIYLIHRNPLVW
KDPLVFDPLRFSPENVSGRHSHAFLPFAAGMRNCIGQQFAMIEMKVALALILLRFELSPD
LTNPPHKIPRLILRSKNGIHLYLKKIH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgacgtggttcggcgtggatgtggcccgggtgctgcacttggccgccgtcttc
tgcctgacgtgcgtgctgctgaaggccatccagctgtaccaccggcggcgggagctgctg
cgggcgctgtccgccttccccgggcaccccacgcattggctgctcgggcacgttcaggag
tttctcaaagaagaagatgtgctggaaaaggcagaggcatgggcactgaagtaccaacat
gcccaccctatctggtttgggggtttctcggcagtcctggtgatcaacgatcctgaatat
gccaaagccctttttgccagaggagatcccaaggataacctcagctataagcaccttatc
ccatggattgggaatggcttgctgatcctgcatgggcccaaatggcaccaacatcggaag
ctcctgacaccaggctttcattacgacgtcttgaagccttatgtagccctcatggcagag
tctaccaatgtgatgctggataagtgggaaaagctgatcacaaatgggaaatcggtggag
ctctttgagcacgtcagcttgatgactctcgacagcatcatgaaatgtgccttcagctac
cacagcaactgccagaccgacaggcaaaacacctacatccaggctgtctatgacctgtgc
cgcatggtgcacgagcgactccgcatcttcccctaccacaatgacttcatttactggctc
agcccccatggataccagttcaggaaggtttgccagcttgctcacgaccacacagacaaa
gtgatccaggagcgaaaggagtcccttaaagatgaacgggagtttgagaagatcaagaag
aagaggcatttggacttcctggacattctactctgtgctaaggatgagaccggagctggc
ctgtctgatgaggacctgcgtgctgaagtggacacgttcatgtttgaggggcatgacacc
acagccagtgggctctcatgggtcctgtactgcctggcgtcacaccccgagcaccaggca
cggtgcagggaggagatcaaggacatcctgggcagtcgggacaccattcagtgggaagac
ctggggaagatgacctacagcaccatgtgcatcaaggagagccttcgcctctacccaccg
gtgcctggcgtgtcccggcagctcagcaagcccatcaccttccatgatggtcgcaccctg
ccagaaggcactatcactgcaataagcatttatctcattcaccgaaatcccttggtatgg
aaggatcctttggtgtttgacccactgcggttttctccagagaacgtatctggcaggcac
tctcacgcctttctgccttttgctgctggaatgaggaactgcattgggcagcagtttgcc
atgattgagatgaaggtggccctggcgctgatcctgctccgcttcgagctgtcccctgac
ctcaccaatcccccccataagatacctcggctcatccttcgctccaagaacggcattcat
ttgtacttaaagaaaatccattga

DBGET integrated database retrieval system