KEGG   Gallus gallus (chicken): 772201Help
Entry
772201            CDS       T01006                                 

Gene name
ASPG
Definition
asparaginase homolog (S. cerevisiae)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     772201 (ASPG)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     772201 (ASPG)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     772201 (ASPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 597 aa AA seqDB search
MEAAVMRGSLGRALCGTHREDLPGCKAVSEARVLVINTGGTIGMVQDDKGLAPKANKLVS
SLKTMPMLHDDAYAQETKLCNLHEFPDDTLVLPVSKQNKRIFYTILELSPLLDSSNMTPE
DWAKIAKKLEEHYEKYDGFVILHGTDTMAYTASALSFMCENLGKTVVLTGSQVPIYELQN
DGRANLLGALLFAGQFVIPEVCLYFYNKLYRGNRVTKVDAGSFNAFSSPNLPPLANAEVD
ITINWETVCRANTKKKFRVHTNMNRNVGLLRIFPGITAAAVKAFLQPPIEGIVLETYGSG
NAPNNREDLLEELKRATERKVVILNCTQCLRGSVTTVYATGQTLADVGVIPGYDMTPEAA
LTKLSYTLSKSKLSWEEKRQMLSENLRGEMTVVPTGAKISLRDSKFIQVIARSLSISCKE
ELEAVRDALIPLLACAAAKLGDVDALRAIAEMGGNLSCEDYDGRTPLHIAASEGHLPSVE
YLLTSGATVYARDRYGSSPLMNAIKFRHIHVINLLRETGAHLSSHDLENTGTILCSLAAK
GDVDGLCAWYLAGADLEQTGYDGKNALQVAEATEHKEVLDFLRQKQQKKAVEDGHSS
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggtgatgcggggctctctgggcagagccctgtgcggcacccaccgcgag
gatctcccgggctgtaaggccgtcagcgaggcgcgggtgttggtcatcaacacgggcggc
accatcggcatggtgcaggacgataagggacttgctcccaaggccaataagttagtaagc
agcttgaagacgatgccaatgctgcatgatgatgcctatgcccaggaaacaaaactgtgc
aacctccatgaatttccagatgacacattagtgctccctgtctctaagcaaaacaaaaga
attttctacacaatcctggagctgtcaccactactggattcttcaaacatgacgccggag
gactgggccaaaattgcaaagaaacttgaggagcactatgaaaagtatgatggctttgtg
atcctccatggcaccgacacaatggcatacacagcttcagccttatccttcatgtgtgag
aacctgggtaaaactgttgttctgacgggatcgcaggtgcccatatatgagctgcagaac
gacggccgagccaaccttctgggggcactgctttttgctgggcagttcgtgattcccgag
gtgtgcctgtatttttataataaactgtacaggggaaatagggtgactaaggtggatgct
gggagtttcaatgccttttcctcacctaacctgcctccacttgcaaatgctgaggttgat
attacaataaactgggaaacagtatgcagagccaataccaagaagaaatttcgagttcat
accaatatgaacaggaatgttgggcttctgcgaatattcccaggaataactgctgctgct
gtgaaagcatttctccagcctccaattgagggcattgtacttgaaacttatggaagtggc
aatgccccaaataacagagaagacttgctggaagaacttaagagagcaactgaacgtaaa
gtagtgattctaaactgcacccagtgcttgcgaggctctgttacaacagtctacgcaaca
gggcagactctcgctgatgttggagtaattcctggatatgatatgacaccagaggcagcc
ttaactaaactgtcatacacgctcagcaagagtaagctcagctgggaggagaagagacag
atgctgagtgagaatctaagaggagaaatgactgttgtacccacaggagccaagatctct
ctcagagatagcaagtttattcaagtgattgccagatctctaagtatcagctgcaaggag
gagttagaagctgtaagagatgcattaattccacttttggcttgtgctgcagctaaactg
ggtgacgtagacgcactgagagccatagcagaaatgggtggaaacctaagctgtgaagac
tatgatggccgaactccacttcatattgcagcctctgaagggcatttaccatcagttgag
tatttgttaacatctggtgcaactgtttacgctagagacagatacggatcttccccactg
atgaatgcgatcaagttcaggcacatacatgtgatcaatttgttacgagaaacaggagca
catctttcaagccatgacttggagaacactggaacaatactttgcagccttgcagctaaa
ggtgatgtggatgggctgtgcgcctggtacctggctggggcagacctggagcaaactggt
tatgatggcaagaacgccctacaagtagcagaggctacagagcataaggaggttcttgac
ttcctcagacagaagcaacaaaagaaggctgtagaagatggtcactcctcttag

DBGET integrated database retrieval system