KEGG   Gallus gallus (chicken): 772289Help
Entry
772289            CDS       T01006                                 

Gene name
CRYZ
Definition
crystallin, zeta (quinone reductase) (EC:1.6.5.5)
Orthology
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
8
AA seq 331 aa AA seqDB search
MAAAAARGAMRAVRVFEFGGPEVLRLQADVPIPSPEDAQVLIKVHACGVNPVETYIRSGN
YARKPALPYTPGSDVAGVIEGVGGRVTAFKKGDRVFTSATLSGGYADYAVAEADTVFPLS
DKLSFSQGAAIAIPYFTAYRALFLKGHAKAGESVLIHGASGGVGIAACQIARVYGLKVLG
TAGTEQGMNVVLRNGAHQAFNHREANYLDKIMEYTKMQGVNIIIEMLSNVNLAADLHLLS
HAGRVMVVGCRGPIEINPRDTMNKESSIRGVSLFLQTEEERRECVRAVLDGIESGWLKPV
VGPEYPLQEVAKAHEDIIHSSGARGKMVLLP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcagccgcaaggggtgcgatgagggcggtccgggtgtttgagttcgggggc
cccgaggtgctgaggctgcaggcagatgtccccatcccctctccggaggacgctcaggtg
ttgattaaggtccacgcctgcggggtaaaccctgtggagacctacatccgttctgggaac
tacgcgagaaaaccggccttgccttacacgcccggctccgacgtggctggtgtgattgag
ggtgttgggggacgcgtgactgcattcaagaaaggtgacagggtttttacctctgctacg
ctctctggaggatatgcagattatgcagttgctgaagctgatacagtctttcctttgtcg
gacaagttgagtttcagtcaaggagcagcgattgcaataccctacttcactgcttaccgt
gctcttttcctaaaagggcatgccaaagcaggggaaagcgtgctaattcatggtgcaagt
ggaggcgtgggaatagcagcatgtcagattgccagagtttatggcttgaaggttttgggc
acagcgggaaccgagcagggtatgaacgttgttctgagaaatggtgctcaccaagcattt
aatcacagagaagctaactatcttgacaaaattatggaatataccaagatgcaaggagtt
aatataataatagaaatgctctccaatgtcaatctggctgctgacctgcatctgctgtcc
catgcaggaagggtgatggttgtcggctgcagaggtcccattgagataaatcccagagac
accatgaacaaagagtccagcataagaggagttagtctgtttcttcagactgaggaggag
agacgtgaatgtgtgagggcagtccttgatggcatagagtctggctggctgaaaccagtg
gtaggccctgagtacccactgcaggaagtagctaaggctcatgaggacattattcacagc
agtggtgctcgaggaaagatggtactcttgccataa

DBGET integrated database retrieval system