KEGG   Gallus gallus (chicken): 772291Help
Entry
772291            CDS       T01006                                 

Gene name
SRD5A2
Definition
(RefSeq) steroid 5 alpha-reductase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    772291 (SRD5A2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     772291 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 772291
NCBI-ProteinID: XP_001235447
CGNC: 8069
Ensembl: ENSGALG00000010625
UniProt: F1NUW1
Position
3
AA seq 255 aa AA seqDB search
MQCFPSLVLALSSLLGALALLQLSLYLRVPSRYGKHEERLCRPRGRLPARCAWFVQELPS
FLVPALLLALRSPPRLEPLGCRLLCCLFCWHYFYRTFIYPFFTRGRPFPLQLLFFGTLFC
VYNGFLQGYYLIYCAEYPNDWCTDIRFTSGLLLFLLGMGINIHSDLLLRQLRKPGEVTYK
IPQGGLFTYVSGANYFGEIVEWFGFAIATWSLPAFTFAFFTLCCIGPRAYHHHRYYLKTF
TDYPKSRKALIPFVF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcttccccagcctggtgctggcgctcagctcgctgctgggcgccctggcgctg
ctgcagctctcgctctacctgcgcgtgccgtcccgctacggcaagcacgaggagcggctg
tgccgcccgcggggccggctgcccgcgcgctgcgcctggttcgtgcaggagctgccctcc
ttcctcgtgcccgcgctgctgctggcgctgcgcagcccgccccgcctcgagccgctgggc
tgccgcctgctctgctgcctcttctgctggcactacttctacaggacatttatttacccc
ttcttcactagaggccggcctttcccactgcagttgcttttctttggcacattattctgt
gtctataatggcttcctccaggggtactacctgatctactgtgctgaatacccaaacgat
tggtgcaccgacatccgatttacatcaggcctcctcttatttctgctgggaatgggaatc
aacattcacagcgatctccttctgcgccagctgagaaaacccggggaagtcacttacaag
attcctcaaggggggctgttcacttatgtttctggagccaactactttggagaaatcgtg
gaatggtttggttttgccatcgctacctggtccctaccagccttcacctttgcctttttc
actctttgctgcattgggccccgtgcttaccaccatcacaggtactatctcaagacattt
acggactatccaaaatcaaggaaagccttgattcctttcgttttttaa

DBGET integrated database retrieval system