KEGG   Gallus gallus (chicken): 776273Help
Entry
776273            CDS       T01006                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    776273
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    776273
   04370 VEGF signaling pathway
    776273
   04020 Calcium signaling pathway
    776273
   04070 Phosphatidylinositol signaling system
    776273
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     776273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
2
AA seq 1301 aa AA seqDB search
MSVSRLNSVNGFLEDGRMEAGDIGRILRCLEMGTVLTLFYQKKSQRPERRTFQVKLETRQ
IIWSRTPEKVEGDIDIREIKEIRLGKNSRDFERYPEDARKLDFTMCFIILYGMDFRLRTL
SVAAFCEEDINLWITGLNWLVADTQKAQTPLQIERWLRKQFDGMDRSREGSITVKDLKAM
LPQVNYRVPNMRFLRDKLVEVEARNEMTFSHFIQFYKNLMFDAQKSVIEQLELSFPLRNV
DRPELCQVSLYDFQKFLLHDQKEPWASDVGMVRDYMCSYLKDGSIDAAEPSFQLDEFLTY
LFSKENMVMDAKYERVVPEEMNHPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGC
RCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKEHAFVTSEFPIILSIEDHCSIVQ
QRNMASHFKKVFGDMLLTKPVDINADELPSPTQLKKKILIKHKKLVEGNLYEEVSTASYS
ENDISNSIKNGILYLEDPIDHTWSPHYFVLTSNKIYYSEETSRYQFNEDEEEVEQKEEFN
NNELHFTEKWFHGKLGGGRDGRQIAEKLLHEYCTETGGKDGTFLVRESETFVGDYTLSFW
RSNRVQHCRIHSRQEAGSTKFYLTDNLVFDSLYSLICHYREVPLRCNEFEMRLTDPVPQP
NAHESKEWYHASLTRLQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCRIQQE
GRLFMLGSSAEFESLVDLVSYYEKHPLYRKMKLRYPINEETLEKMGTTELDYGALYEVRT
PHFYVEANKMPMARCTVKALYDYKAQREDELSFCKQAIIHNVDKQDGGWWRGDYGGKKQL
WFPANYVEEIVSTQAQEQDEASSENSPLGNFLKGFIDVPSCHVVISKDGRSSKPFVFTIH
SQQMSHAAQSLDVAADTQEELSEWVAKIREATQNADARMQEGKIMERRKKIALELSELVV
YCRPVPFDEDKIGTDKACYRDMSSFPETKAEKYANRSKGKKFLQYNRRQLSRIYPKGQRL
DSSNYDPLPMWICGSQLVALNFQTPDKPMQLNQALFMLGGRSGYVLQPDIMRDETFDPFD
KNSLKIVEPITVQLQILGARHLPKNGRSIVCPFVEVEVCGSEYDNSKNKTDVVADNGFNP
VWLFKQFVFDINNPEFAFLRFVVYEEDMFSDPNFLAQATFPIKGLKTGYRSVPLKNSYTE
DLELAALLIHIEIINAKVSIVDKLETPVPRFPSGSIPIHPVILIPLCWSRRKTRRTSTHP
SSSCGTVPVSSPARSPAMSAPTTATHATSSASMSCEQPRSG
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgtccaggctcaacagcgtcaatggctttttggaggacggcaggatggaggca
ggggacattggaaggatcctccgctgcctggagatgggcaccgtcctcactttgttctac
cagaagaagtcacagaggccagagaggaggacgttccaggtgaagctggagacccgacag
attatctggagtcggacacccgagaaggtggagggagacattgacattcgggagatcaag
gagatccgcctggggaagaactcacgggactttgagcgttaccccgaggatgctcgcaag
ctcgacttcactatgtgcttcatcatcctctatgggatggacttcaggctgcggacactc
agcgtggctgctttctgtgaggaagacatcaacctgtggatcacaggtctcaactggttg
gtggcagacacccagaaagcccagaccccgctgcagattgagaggtggctgcgaaaacag
tttgatgggatggaccggtctcgggaaggcagcattacagtgaaggacctgaaggccatg
ctgccccaggtgaactacagagtgcccaacatgaggttcctgcgggacaagcttgtggag
gtggaagccaggaatgagatgaccttctcccactttatccagttctacaaaaacctgatg
tttgatgcgcagaagtcggtcattgaacagctggagctctccttccctctacggaacgtg
gaccgccctgagctgtgccaggtgtctctctacgacttccagaagttccttctgcatgac
cagaaggagccgtgggccagtgatgtgggcatggtgcgggactacatgtgttcctacctc
aaggatggctccatcgatgcagcagaaccctccttccagttggatgagttcctcacgtac
ctcttctccaaggagaacatggtgatggatgccaagtatgagcgtgtggtacctgaggag
atgaaccaccctttgtcccagtactggatctcctcttcccacaacacgtacctgacagga
gaccagttctccagtgagtcctccctggaggcgtatgcccgctgcctgcgcatgggctgc
cgttgcattgagttggactgctgggatggcccagatgatctccccatcatctaccatggt
cacacactcacctccaagatcaaattcctggacgtgctgcataccatcaaggagcacgca
tttgtcacatctgagtttcccatcatcctctccattgaagaccactgcagcatcgtccag
cagaggaacatggcttcccacttcaagaaggtttttggggacatgctgctcaccaagcca
gttgacatcaatgctgatgagctgccctcacccacccaactcaagaagaagatcctaatc
aagcacaagaagctggttgaagggaacctatatgaggaggtctccaccgccagttattca
gagaacgacatcagcaactccatcaagaatggcatcctctacctcgaagaccctattgac
catacctggagcccgcattattttgtactgacaagcaacaagatctactactcggaggag
acatcacgctaccagttcaatgaagatgaagaggaggtggagcagaaggaggagttcaac
aacaacgagctgcacttcacggagaagtggttccatgggaagctgggaggtggccgtgat
gggcggcagattgctgagaagctgctacatgaatactgcactgagacaggaggcaaggat
ggcaccttcctggtgcgcgaaagcgagaccttcgtgggtgactacaccctgtccttctgg
cgatcaaaccgtgtgcagcactgcaggatccactcacgacaggaggctggttccaccaag
ttctacctgacagacaacctggtctttgacagcctctacagtctcatctgccactaccgt
gaggtgccactccgctgcaatgagtttgagatgcgcctcactgaccccgtgccccagccc
aatgcccacgagagcaaagagtggtatcatgccagcctgacacgccttcaggctgagcac
atgctgatgcgagtccctcgggatggagccttcctggtgcgaaaaaggagcgaacccaat
tcctacgccatttcattccgggcggaggggaagatcaagcactgccgcatccagcaggag
ggacgactcttcatgctgggcagctcagccgagtttgagagcctggtggaccttgtcagc
tactatgagaagcatccgctgtaccgcaagatgaagctgcgctaccccatcaatgaggag
accctggagaagatgggcaccactgagctggactatggggctctgtacgaggtgcggaca
ccccatttctatgtggaggccaacaagatgccaatggccaggtgcacagtgaaggctctt
tatgactacaaagcacagcgggaggacgagttgtcgttctgcaagcaagccatcatccac
aacgttgacaagcaggatggtggctggtggcggggggactatgggggcaagaaacagctg
tggttcccagccaactacgtggaggaaatcgttagcactcaggcgcaggagcaggatgag
gcttcatcggaaaacagccccctggggaacttcctgaagggcttcatcgatgtgccatca
tgccacgttgttatctccaaagacgggaggagctccaaaccatttgtcttcaccatccat
tcccagcagatgtcccacgcagcccagtcactggacgtggccgctgacacacaggaggag
ctcagcgagtgggtggccaagatcagggaggccacgcagaacgccgatgccaggatgcaa
gaggggaagattatggagcggaggaagaagatcgctctggagctctccgagctggttgtg
tattgccgccccgtgccattcgatgaagacaagataggcacagacaaagcttgctacagg
gatatgtcctcgttcccggagaccaaagcggagaagtacgccaaccgcagcaagggcaag
aagttcctgcagtacaaccggcgccagctcagccgcatctaccccaaagggcagcgcctg
gactcctccaactacgacccactgcctatgtggatctgcggcagccagctggtggccctc
aacttccagacacccgacaagccgatgcagctgaaccaggcgctcttcatgctcggcggc
cgcagtggctatgtcctacaacccgacatcatgagggatgagacgtttgaccccttcgac
aagaacagcctgaagattgtggagcccatcacagtgcagctgcagattcttggtgcccgg
caccttcccaagaatgggagaagcattgtgtgcccctttgtggaggtggaggtttgtggc
tccgagtatgacaacagcaagaacaagactgatgttgtagctgacaatggtttcaacccc
gtgtggctcttcaagcagtttgtcttcgacatcaataaccccgagttcgccttcctccgc
tttgtggtgtatgaggaggacatgttcagtgaccccaatttcttggcccaagccaccttc
cccattaagggtctcaaaacaggctaccggtcggtgccactgaagaacagctacacagag
gacctggagctggccgcactcctcatccacattgagatcatcaacgccaaggtaagcatc
gtggacaagttggaaacacccgttcctcgtttccccagtggatcaatccccatccaccct
gtgatcctcatccctttgtgttggagcaggaggaagacgaggagaacctctactcatcca
tccagcagctgcgggaccgtaccagtgagctctccagccaggtctccagctatgagcgca
ccaacaactgcgactcacgctaccagcagcgcctcgatgagctgcgagcagcccaggagc
ggctga

DBGET integrated database retrieval system