KEGG   Gallus gallus (chicken): 417946Help
Entry
417946            CDS       T01006                                 

Gene name
HIST1H46, H1, H4
Definition
(RefSeq) histone cluster 1, H4-VI, germinal H4 (similar to human histone cluster 1, class H4 genes)
  KO
K11254  
histone H4
Organism
gga  Gallus gallus (chicken)
Brite
Chromosome [BR:gga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    417946 (HIST1H46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagaggcaagggcgggaaggggctcggcaagggcggcgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggcatcaccaagccggccatccgccgcctggcgcgg
cgcggcggcgtcaagcgcatctcggggctcatctacgaggagacgcgcggcgtgctcaag
gtcttcctggagaacgtcatccgcgacgccgtcacctacaccgagcacgccaagaggaag
acggtcacggccatggacgtggtctacgcgctcaagcgccagggacgcaccctctacggc
ttcggcggctaa

DBGET integrated database retrieval system