KEGG   Geobacillus sp. GHH01: GHH_c01810Help
Entry
GHH_c01810        CDS       T02455                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ggh01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ggh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162366..163265
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIW
YDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcgtcatcgaacgtctggaacgtcttcat
tacgatattgaagatttgggagatattccgattggaaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcggcg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgctgggcggcgaccatagc
atcgccattggcacgctcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcatggcgacgtcaacaccgcggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcgcctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgag
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagtggctgtagcgctgatggggtcgttgtttggtgaaaaactcatgtaa

DBGET integrated database retrieval system