KEGG   Geobacillus sp. GHH01: GHH_c14830Help
Entry
GHH_c14830        CDS       T02455                                 

Gene name
pheF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00360  Phenylalanine metabolism
ggh00362  Benzoate degradation
ggh00620  Pyruvate metabolism
ggh00621  Dioxin degradation
ggh00622  Xylene degradation
ggh00650  Butanoate metabolism
ggh01100  Metabolic pathways
ggh01120  Microbial metabolism in diverse environments
ggh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GHH_c14830 (pheF)
   00650 Butanoate metabolism
    GHH_c14830 (pheF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GHH_c14830 (pheF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GHH_c14830 (pheF)
   00622 Xylene degradation
    GHH_c14830 (pheF)
   00621 Dioxin degradation
    GHH_c14830 (pheF)
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GHH_c14830 (pheF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored TrkA_N DapB_N CoA_binding ADH_zinc_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGE22014
UniProt: L7ZXY9
Position
1493418..1494317
Genome map
AA seq 299 aa AA seqDB search
MEKINVAILGSGNIGTDLMLKLERSDVLQLTTVIGIDPQSEGLRLAKEKGYHVIDSGIQA
FLEHPEWADFVFDATSAKAHIRHAKLLKQAGKVVFDLTPAAVGPFVVPPVNITEHLEETN
INFITCGGQATIPIVHAIGRVQPVAYAEIVATISSKSAGPGTRANIDEFTETTARGLEKI
GGAKRGKAIIILNPAEPPILMRNTIYALVEGKKAAAREICDSIEEMVETIRSYVPGYRLR
TSPIIEGNKVTVMVEVEGAGDYLPKYAGNLDIMTAAAVKVAEEVAKHRLSKLLAEEGKR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaatgtagcaattcttggttctgggaacatcgggactgacttgatgttg
aagcttgaacgttcggatgtgttgcagttgacaacagtaattgggatcgatcctcaatcg
gaagggctgcgtctagcaaaagagaaagggtatcacgtcattgacagcggcatccaagcg
tttttggagcatcccgaatgggctgatttcgtcttcgacgcgacgtcggcgaaagcgcac
atccgtcatgccaaactgttgaagcaggctgggaaggtcgtctttgatttgactccggcg
gccgttggaccgtttgttgtgccgcctgtcaatataacggaacatttggaagagaccaac
attaacttcatcacatgcggtggacaggcgacgattccgatcgttcatgccattgggcgc
gtgcagccggtcgcttacgctgaaattgttgcgacgatttcaagcaaaagtgcagggccg
ggaacaagagcgaacattgatgaatttacagaaacgactgctcgagggctcgaaaaaatc
ggtggggcgaagcgcggaaaagccatcattattctcaacccggctgaaccgcccattttg
atgagaaacacaatatacgcacttgtcgaagggaagaaagcagcggcgcgggaaatttgc
gactcgatcgaggaaatggtagaaacgatccgctcgtacgttcccggctatcggctgcgc
acgagtccgatcattgaaggaaataaggtgacggtcatggttgaagtggaaggagcgggt
gattatttgccgaagtacgctggaaacttggatattatgaccgccgctgcggtgaaagtg
gcggaggaagtggcgaagcatcgattatcgaagttgttggctgaggaggggaaacgatga

DBGET integrated database retrieval system