KEGG   Geobacillus sp. GHH01: GHH_c14830Help
Entry
GHH_c14830        CDS       T02455                                 

Gene name
pheF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GHH_c14830 (pheF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GHH_c14830 (pheF)
   00650 Butanoate metabolism
    GHH_c14830 (pheF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GHH_c14830 (pheF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GHH_c14830 (pheF)
   00622 Xylene degradation
    GHH_c14830 (pheF)
   00621 Dioxin degradation
    GHH_c14830 (pheF)
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GHH_c14830 (pheF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1493418..1494317
Genome map
AA seq 299 aa AA seqDB search
MEKINVAILGSGNIGTDLMLKLERSDVLQLTTVIGIDPQSEGLRLAKEKGYHVIDSGIQA
FLEHPEWADFVFDATSAKAHIRHAKLLKQAGKVVFDLTPAAVGPFVVPPVNITEHLEETN
INFITCGGQATIPIVHAIGRVQPVAYAEIVATISSKSAGPGTRANIDEFTETTARGLEKI
GGAKRGKAIIILNPAEPPILMRNTIYALVEGKKAAAREICDSIEEMVETIRSYVPGYRLR
TSPIIEGNKVTVMVEVEGAGDYLPKYAGNLDIMTAAAVKVAEEVAKHRLSKLLAEEGKR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaatgtagcaattcttggttctgggaacatcgggactgacttgatgttg
aagcttgaacgttcggatgtgttgcagttgacaacagtaattgggatcgatcctcaatcg
gaagggctgcgtctagcaaaagagaaagggtatcacgtcattgacagcggcatccaagcg
tttttggagcatcccgaatgggctgatttcgtcttcgacgcgacgtcggcgaaagcgcac
atccgtcatgccaaactgttgaagcaggctgggaaggtcgtctttgatttgactccggcg
gccgttggaccgtttgttgtgccgcctgtcaatataacggaacatttggaagagaccaac
attaacttcatcacatgcggtggacaggcgacgattccgatcgttcatgccattgggcgc
gtgcagccggtcgcttacgctgaaattgttgcgacgatttcaagcaaaagtgcagggccg
ggaacaagagcgaacattgatgaatttacagaaacgactgctcgagggctcgaaaaaatc
ggtggggcgaagcgcggaaaagccatcattattctcaacccggctgaaccgcccattttg
atgagaaacacaatatacgcacttgtcgaagggaagaaagcagcggcgcgggaaatttgc
gactcgatcgaggaaatggtagaaacgatccgctcgtacgttcccggctatcggctgcgc
acgagtccgatcattgaaggaaataaggtgacggtcatggttgaagtggaaggagcgggt
gattatttgccgaagtacgctggaaacttggatattatgaccgccgctgcggtgaaagtg
gcggaggaagtggcgaagcatcgattatcgaagttgttggctgaggaggggaaacgatga

DBGET integrated database retrieval system