KEGG   Geobacillus sp. GHH01: GHH_c18050Help
Entry
GHH_c18050        CDS       T02455                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GHH_c18050 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GHH_c18050 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GHH_c18050 (thrC1)
Enzymes [BR:ggh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GHH_c18050 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1799270..1800487)
Genome map
AA seq 405 aa AA seqDB search
MSFSYVSHLYCPKCERTYDVDQIHQLCECGSPLLVAYDLELMRQEVKREALAEREPSLWR
YHELLPVKHPEHIVSLGEGMTPLVRMPRLGRNIGIDSLYMKDEGVIPTGTFKARGAAVGI
SKAKELGVKRLAMPTNGNAGAAWSLYAARAGIQATVVMPVDAPELTRKECAIAGAELYLV
NGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKAIKELQALGWVDGRMPRLVAVQAEHCAPIVKAWKEKKRESEFWPNAHTVAF
GINVPKALGDFLVLEAVYETDGCAVAIGDEAILAEQRTAAELEGAFICPEGAAAFAAART
LRESGWIRDGETVVVLNTGTGLKYADTVDVHPPVLEPGDMLPKEN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcagctacgtgtctcatctgtattgtccgaagtgtgaacgtacatacgatgtc
gaccaaatccatcaactttgcgaatgcggttcgccgcttctggtcgcgtacgatttggag
ttgatgcgccaagaagtgaagcgggaggcacttgcggagcgagaaccgagtttatggcgg
tatcatgagctattgccggtgaaacatcctgaacatattgtctctttaggggaaggaatg
actccgcttgtgcgaatgccgcgccttggccggaatatcggcattgactcactctatatg
aaagacgaaggcgtcattccgaccgggacgtttaaagcccgcggcgcggcggttgggatt
tcgaaagcaaaggaattgggcgtcaaacgactcgccatgccgacaaacggcaacgccggc
gcggcatggtcgctatacgcggcgcgggcgggcattcaggcgacagtcgtcatgccggtt
gatgcaccggaactgacgcgaaaggaatgcgccatcgctggggcggaactgtatttagtc
aacggcctcattagcgatgccgggcaaatcgtcgccaaagcgatccgcgaatacggatgg
tacgatgcgtcgacgttgaaagaaccgtaccggattgaagggaagaaaacgatgggactg
gagatcgccgaacagttctcgtggcagctcccggatgtcattttgtatccgaccggcggc
ggcgtcgggttgatcggcatttacaaggcgatcaaagaactgcaggcgctcggctgggtg
gacggccgcatgccgcggcttgtcgctgtgcaggccgagcattgcgcgccgatcgtcaag
gcgtggaaggagaaaaaacgtgaatcggagttttggccgaacgcccatacagtggcgttt
ggcatcaatgtgccgaaagcgcttggcgactttcttgttcttgaggcggtgtatgagacg
gacggttgcgcggttgccattggcgatgaagcgattttggctgaacagcggacggcagcc
gaactcgaaggggcgttcatttgcccggaaggagcggcggcgtttgcggcggcacgaacg
ttgcgcgagagcggttggattcgcgacggggagacggtcgtcgtattaaataccggaacc
gggctgaaatacgccgatacggtggacgtccatccgccggtgctcgagccgggggatatg
cttccaaaggagaattga

DBGET integrated database retrieval system