KEGG   Geobacillus sp. GHH01: GHH_c18660Help
Entry
GHH_c18660        CDS       T02455                                 

Definition
thermostable monoacylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ggh  Geobacillus sp. GHH01
Brite
Enzymes [BR:ggh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GHH_c18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1856008..1856760)
Genome map
AA seq 250 aa AA seqDB search
MSEQYPVLPGAEPFYAENGPAGVLLVHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGT
HYEDMERTTFHDWIASVEEGYEWLKKRCQTIFVTGLSMGGTLTLYMAERYPSIRGIVLIN
AAIDIPAIRAGMAAGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMEQVKGE
LERVTCPILIFVSNEDHVVPPENADIIFRGVHSSDKEIVRLKNSYHVATLDYDQTTIIER
SLEFFAKHAD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaatacccggtgctccctggcgccgagccgttttatgccgaaaacgggccg
gccggggtgctgctcgtgcacgggttcaccggcacgccccacagcatgcgcccgctcgct
gaggcgtatgcgaaagccggctacacggtctgcctgccgcgcttaaaagggcacggaacg
cattatgaagacatggagcggacgacgttccacgactggatcgcctcggtcgaagaagga
tatgaatggctgaaaaaacgatgccaaaccatttttgtcaccggtctgtccatgggtggg
acgctgacgctttatatggcggaacgttacccgtccatccgcggcatcgtcttgatcaat
gcggcgattgacattccggccattcgcgctgggatggcggccgggggtgagctgccgagg
tatctggattcgatcggttcggatttgaaaaatccggatgtgaaagagctggcgtacgag
aaaacgccgacggcttcgcttcttcagctggctaggctgatggagcaagtgaaaggcgaa
ctggaacgtgtgacatgcccgattttaattttcgtctcgaacgaagaccatgtcgtgccg
cctgagaacgcggacatcatttttcgcggcgtccactcgtcagacaaagagatcgttcgg
ctgaaaaacagctatcatgttgcgacacttgattacgaccaaacgacgattatcgaacga
tcgctggaatttttcgctaagcatgcggattga

DBGET integrated database retrieval system