KEGG   Geobacillus sp. GHH01: GHH_c20900Help
Entry
GHH_c20900        CDS       T02455                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GHH_c20900 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GHH_c20900 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    GHH_c20900 (proB)
Enzymes [BR:ggh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GHH_c20900 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2106986..2108110
Genome map
AA seq 374 aa AA seqDB search
MKRQRVVVKIGSSSLTDPKGGLCRDKLHGHVEAIAYLKQLGHDVILITSGAVAAGFGPLG
YPARPTTIAGKQAAAAVGQSLLMQAYSSAFARFGFTAAQLLLTRSDFYSRERFRNLFATM
TTLLEHGAIPIINENDSVSVEELTFGDNDMLSALVAGFLHADALMLLTDINGLYDANPKT
NPQAKKYAFLPHITDEMIEAAGGSGSAVGTGGMRSKLLAAQKALSFGVSVFIGTGRGKEA
LADILAGKGDGTYIGAPFPKQMQMHKQWIAYHAPVAGTITVDSGAEEALLARGKSLLPAG
VTAVSGDFHAMDVVDVVNEKGITIGRGQVYYAAADLEKVKGLPSEEARQYSYLHRPEVIH
RDNWVTLRKESVFK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggcagcgcgtggtggtcaaaatcggcagcagctcgctcaccgatccgaaaggc
ggcctttgccgcgacaagctgcacggccatgttgaagccatcgcctatctgaaacagctc
ggccatgacgtcattctcatcacgtccggcgctgtcgccgccgggttcgggccgctcggc
tacccggcgcggccgacgacgatcgccggcaaacaggccgcggctgccgtcgggcaaagc
ttgctcatgcaggcgtacagctcggcgttcgcccgctttggcttcacggccgcccaattg
ttgttgacgcgcagcgacttttacagccgcgaacggtttcgcaacttgttcgccacgatg
acgacgctgctcgaacacggggcgatcccgatcatcaatgaaaacgactccgtttccgtt
gaagaattgacgtttggcgacaacgatatgctgtcggcgcttgtcgccggctttttgcac
gccgatgcgctcatgttgcttaccgacattaacgggctgtatgacgccaacccgaaaacg
aatccacaagcgaaaaaatacgcctttttgccgcacattaccgacgaaatgatcgaagcg
gccggcggcagcggctcggcagtcggcaccggcggcatgcgctcaaagcttctcgccgct
caaaaagcgttgtccttcggcgtcagcgtctttatcggcaccgggcgaggcaaagaagca
ctcgccgatattttagccggaaaaggtgatgggacgtacatcggcgccccatttccgaag
caaatgcaaatgcacaagcaatggatcgcgtatcacgcgcctgtcgccggcacgatcacc
gtcgacagcggcgcggaggaagcgctccttgcgcgcggcaaaagcttgcttcccgccggc
gtcacggccgtttccggcgactttcatgcgatggatgtcgtcgatgttgtcaatgagaaa
gggatcacgatcggccgcggccaagtgtattatgccgccgccgatttagaaaaagtaaaa
ggacttccgagcgaggaagcgcggcaatactcgtacttgcaccgcccggaagtcattcac
cgcgacaattgggtcacgttgcgaaaggagagtgtattcaaatga

DBGET integrated database retrieval system