KEGG   Geobacillus sp. GHH01: GHH_c22910Help
Entry
GHH_c22910        CDS       T02455                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ggh01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ggh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2306573..2307352)
Genome map
AA seq 259 aa AA seqDB search
MMLEQILAAKREEVETLTLPAPLPERKRRPFAAALRRPRRMLGLIAEVKKASPSKGIIRP
DFDPVAIAKAYERAGADAISVLTDERYFQGHRRYLRAVKEAVNVPVLRKDFIIDRRQVEE
SVRLGADAILLIGEALPPETLEELYHEAYSLGLECLVEVHAKETLERIFDRFTPEIVGIN
NRDLHTFVTTLEATKTLAPLIPPSCVIVSESGIGSFNDVKTVKSYGAQAMLVGESLMRQD
DVERAVYRLFGEEDGDDSN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgagcaaattttagcagccaaacgggaagaagtggaaacgttgacgctgccg
gcgccattgccagagcgaaagcgccggccatttgcggcggcgctccgtcggccgcggcgg
atgcttggcttgatcgctgaggtgaaaaaagcgtcgccgtcaaaaggcatcattcgcccg
gattttgacccggtggccatcgcgaaagcatatgagcgcgccggtgccgacgcgatcagc
gtgctgacggatgaacggtatttccaagggcatcgccgctatttgcgagcggtgaaagaa
gcggttaacgttcccgtgctgcgcaaagatttcatcatcgatcggcggcaagtcgaggaa
agcgtccgactcggggcggatgcgattttattgatcggcgaggcgctcccgccggaaacg
ctcgaggagctctatcatgaagcgtacagcttggggctcgaatgtttggtcgaggtgcat
gcgaaagagacgctcgagcggattttcgatcggtttacgccggagatcgtcggcatcaac
aaccgcgacttgcatacctttgtgacaacacttgaggcgaccaaaacgctcgctccgctc
atcccgccatcgtgcgtcatcgtcagcgaaagcgggatcggttccttcaatgatgtgaag
acggtcaaatcgtacggagcgcaggccatgctcgtcggcgagtcgctcatgcgccaagat
gatgtggagcgagcggtctaccggctgtttggggaggaagatggggatgattcgaattaa

DBGET integrated database retrieval system