KEGG   Geobacillus sp. GHH01: GHH_c27950Help
Entry
GHH_c27950        CDS       T02455                                 

Gene name
ysdC
Definition
putative aminopeptidase (EC:3.4.11.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GHH_c27950 (ysdC)
Enzymes [BR:ggh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GHH_c27950 (ysdC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2789069..2790157)
Genome map
AA seq 362 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAKKEGKSGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPYHFDAMPGGGT
DAGAIHLTGSGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDADKVKQLTF
DE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttggacgaaacgttgacgatgctgaaagcgctgaccgatgcgaaaggcgtc
ccgggcaatgagcgggaagcgcgcgatgtgatgaagacatacatagctccgtatgcggat
gaagtgacaacggatggcctcggcagcttgatcgccaaaaaagaagggaaatcgggcggg
ccgaaagtgatgatcgccggccatttggatgaagtcggctttatggtgacgcaaatcgac
gacaaaggattcatccgcttccaaacgcttggcggatggtggagccaagtaatgctcgcc
cagcgcgtgacgatcgtgacgaaaaaaggcgacatcaccggcgtcatcggttcgaagccg
ccgcacattctgccgccggaggcgcgcaaaaaaccggtggaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagcgatggagtggggcgtccgcccgggcgatatg
atcgtgccgtattttgaatttacggtattgaacaatgaaaaaatgctgctcgcgaaagca
tgggacaaccggatcggctgtgcggtcgccatcgatgtgctcaagcagctgaaaggcgtc
gaccatccaaacacggtatacggcgtcggcacggtgcaggaagaagtcggcttgcgcggc
gcgcgcacggccgcccaattcattcagccggatatcgcctttgcggtggatgtcggcatt
gccggcgatacaccgggcgtgtcggaaaaagaagcgatgggcaaactcggcgccggcccg
cacatcgtcctgtacgacgcgacgatggtgtcgcaccgcggcttgcgcgaattcgtcatc
gaagtggcggaagagctgaacattccgtaccattttgatgccatgccgggcggcggtacg
gatgcgggagcgattcatttaacgggcagcggcgttccgtcgctcacgatcgccatcccg
acgcgctacatccactcgcacgccgccattttgcatcgcgacgactacgagaacacggtc
aagctgcttgtcgaagtgatcaaacggcttgacgccgacaaagtgaaacaactgacgttt
gacgaataa

DBGET integrated database retrieval system