KEGG   Geobacillus sp. GHH01: GHH_c29600Help
Entry
GHH_c29600        CDS       T02455                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ggh  Geobacillus sp. GHH01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ggh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2964886..2966928)
Genome map
AA seq 680 aa AA seqDB search
MYGHHFASERMRSSLIAANPTDLEVYLFHEGRLYQSYELFGAHVIRDGGAVGTRFCVWAP
HAREVRLVGSFNDWNGANSPLTKVNDEGVWTIVVPENLEGHLYKYEIITPDGRVLLKADP
YAFYSELRPHTASIVYDLKGYQWNDSSWQRKKRRKRIYDQPMVIYELHFGSWKKKPDGRF
YTYREMADELIPYVLERGFTHIELLPLVEHPLDRSWGYQGTGYYSVTSRYGTPHDFMYFV
DRCHQAGLGVIIDWVPGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDLGKPEV
RSFLISNALFWLEYYHVDGFRVDAVANMLYWPNNDRLYENPYAVEFLRQLNEAVFAYDPN
VLMIAEDSTDWPRVTAPTYDGGLGFNYKWNMGWMNDMLKYMETPPHERKYAHNQVSFSLL
YAYSENFILPFSHDEVVHGKKSLLNKMPGSYEEKFAQLRLLYGYMMAHPGKKLLFMGSEF
AQFDEWKFEGELDWVLFDFELHRKMDEYVKQLIACYKRYKPFYELDHDPRGFEWIDVHNA
EQSIFSFIRRGKKEGDVLVIVCNFTNQAYDDYKVGVPLLAPYREVLNSDAAEFGGSGHVN
SKRLSAFHEPFHGKPYHVRMTIPPFGISILRPVQKRGERKQNEEEVHRHVIGRRARKPAS
LADEKHRETSRAVWGEVPDH
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgtatggccatcattttgcttcggaaaggatgcgatccagcttgattgcggcgaatccg
acagatttagaagtgtatttgtttcatgaaggccgtttgtatcaaagttatgagttgttc
ggcgctcatgtcatccgcgacggcggagcggtcggcactcgcttttgcgtgtgggcgccc
catgcgcgggaagtccgtcttgtcggcagtttcaacgattggaatggggcgaattccccc
ctgacgaaggtgaacgacgaaggggtatggacgatcgttgttccagaaaacttggaaggg
catctctataaatatgagatcatcacaccggatggccgtgttctgttgaaagccgacccg
tacgccttttactccgaattgcgccctcataccgcctcgattgtctacgatttgaaagga
taccagtggaatgattcatcttggcagcggaagaaacggcgaaagcggatttatgaccaa
ccgatggtcatttatgaacttcatttcggttcgtggaaaaagaaaccggacggccgcttt
tatacgtaccgtgagatggccgacgaactcattccgtacgtgctggagcgcggatttacg
cacattgagctgcttccgcttgtcgagcatccgctcgatcgttcgtggggatatcaaggg
accggctattattcggtgacaagccgctatggcacgccgcacgatttcatgtatttcgtc
gaccgctgccatcaagcggggcttggcgtcatcatcgactgggtgccggggcatttttgc
aaggacgcccacgggctgtacatgtttgacggcgcaccgacgtatgaatacgcgaatgaa
aaagaccgagaaaattacgtctgggggacggcgaattttgacttgggcaagccggaagtg
cgcagttttctgatctccaatgcgttgttttggctggagtattaccatgtggacgggttt
cgcgtcgatgcggtcgccaatatgctttattggccgaacaatgaccggctctatgaaaat
ccgtatgcggtcgagtttttgcgccagttgaatgaggcggtgtttgcctatgacccgaac
gtcttgatgatcgctgaagattcgaccgactggcctcgggtgaccgcgccgacgtacgat
ggcggccttgggtttaactacaagtggaacatgggctggatgaacgacatgctgaagtat
atggaaacgccgccgcatgagcggaaatacgcccataaccaagtcagtttttccctcctt
tatgcgtattcggaaaatttcattttgccattttcccatgatgaagttgtgcatggcaaa
aaatcgctgctcaataaaatgcctgggtcgtacgaagagaagttcgcccagctgcgccta
ttgtatggctacatgatggcccaccctgggaaaaagctgctgtttatgggcagtgagttt
gcccagtttgatgaatggaagtttgagggagagctcgactgggtgctgttcgattttgaa
ttgcaccggaaaatggacgaatatgtgaagcagctgatcgcctgctataaacggtataag
ccgttttacgagcttgatcatgatccgagggggtttgaatggattgacgttcataatgcc
gagcaaagtattttctcattcatccgccgggggaaaaaagaaggtgatgtgctggtcatt
gtttgtaatttcacaaatcaggcgtatgacgattacaaagtcggcgtgccgcttttggcg
ccgtaccgcgaagtgcttaacagcgatgcagcggagtttggcggatcagggcatgtcaat
tcgaagcggctttccgctttccatgagccgtttcatggaaaaccgtaccatgtgcgcatg
acgattccgccgtttggcatttccattttgcggccagtgcaaaaacgaggggagagaaag
cagaatgaagaagaagtgcatcgccatgttattggccggcgggcaaggaagccggcttcg
ctcgctgacgaaaaacatcgcgaaaccagccgtgccgtttggggggaagtaccggatcat
tga

DBGET integrated database retrieval system