KEGG   Geobacillus sp. GHH01: GHH_c31190Help
Entry
GHH_c31190        CDS       T02455                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ggh  Geobacillus sp. GHH01
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3104480..3105223)
Genome map
AA seq 247 aa AA seqDB search
MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEE
LVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMY
IKSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKTLKALQELIADVRAHLDL
VYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYA
FLESLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattgttccgccgaagccgtttttctttgaagccggggagcgggcggtgctg
cttttgcatgggtttaccggcaattccgccgacgttcggatgcttgggcgattcttggaa
tcgaaagggtatacgtgccacgctccgatttacaaagggcatggcgtgccgccggaagag
ctcgtccacaccggaccggatgattggtggcaagacgtcatgaacggctatcagtttttg
aaaaacaaaggctacgaaaaaattgccgtggctggattgtcgcttggaggcgtattttct
ctcaaattaggctacactgtacctatagaaggcattgtgacgatgtgcgcgccgatgtac
atcaaaagcgaagaaacgatgtacgaaggtgtgctcgagtatgcgcgcgagtataaaaag
cgggaagggaaatcagaggaacaaatcgaacaggaaatggaacggttcaaacaaacgccg
atgaagacgttgaaagccttgcaagaactcattgccgatgtgcgcgcccaccttgatttg
gtttatgcgccgacgttcgtcgtccaagcgcgccatgatgagatgatcaatccagacagc
gcgaacatcatttataacgaaattgaatcgccggtcaaacaaatcaaatggtatgagcaa
tcaggccatgtgattacgcttgatcaagaaaaagatcagctgcatgaagatatttatgca
tttcttgaatcgttagattggtaa

DBGET integrated database retrieval system