KEGG   Geobacillus sp. GHH01: GHH_c31490Help
Entry
GHH_c31490        CDS       T02455                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00340  Histidine metabolism
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01230  Biosynthesis of amino acids
Module
ggh_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ggh00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GHH_c31490 (hisD)
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GHH_c31490 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGE23640
UniProt: L8A131
Position
complement(3131112..3132386)
Genome map
AA seq 424 aa AA seqDB search
MKIERIRGGVSLRRTIESGTEEQRRAVLDIIANVRARGDAVLKEYTERFDGVSLDSLKVT
EEEMKRAHAAMDAEMLEIIRQAAANIRDYHERQKRESWWMTKEDGTILGQKVTPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKDGTLPAGVLAAAYELGVTEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGHVAIDMIAGPSEIVVLADETAR
PDEIAADLLSQAEHDVRASAILVTPSMKLALAVASEVERQLETLPRRDIAQAALENYGAI
YVTETLEEAVDVVNELAPEHLEVMTAEPLALFGRLRHAGAMFFGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLSVDEFVKKSSVIVYSETALKQHGDKIAAFARLEGLEAHARAIEVRL
EKGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaacggatccgaggcggcgtctcgctgcggcgcacgattgaaagcggaacg
gaggagcagcggcgcgcggtgcttgatatcatcgccaatgtgcgcgcccgcggcgatgcg
gtgctcaaagaatatacagaacggtttgacggcgtaagcttggattcgctcaaggtgacg
gaagaggaaatgaagcgcgcgcatgcggcgatggacgcggagatgctggagatcattcgc
caagcggcggcgaacattcgcgactaccatgagcggcaaaagcgcgaatcatggtggatg
acgaaagaagacggcaccattctcggacaaaaggtgacgccgctcgatgcggtcgggttg
tacgtgccaggcgggacggccgcttatccgtcgtctgtgctgatgaacgttattcccgca
caagtggcgggggtgaaacggattgtcatcacctcgccgccaaacaaagacggcacgctc
ccggctggggtgctggccgccgcctatgaactcggcgtgacggaaatttacaaagtcggc
ggcgcgcaggcgatcgccgcgcttgcttacgggacggaaacgatccggccggttgacaaa
attttcgggccgggcaatatttatgtggcattggcgaagcgggaagtgttcgggcatgtg
gcgatcgacatgatcgcggggccgagcgaaattgtcgtgctggcggatgaaacggcccga
ccggatgagattgcggcggatttgttgtcgcaagccgagcatgacgtgcgggcgtcggcc
attttggtgacgccgtcgatgaaattggcgctggcggtggcgagcgaagtcgaacggcag
ctggaaacgctgccgcgccgcgacattgcccaagcggcgctcgagaactacggcgccatt
tacgtcaccgagacgcttgaggaagcggtggatgtcgtgaacgaactggcgccggagcat
ttggaagtgatgacggcagaaccgctcgcgcttttcggccggctccgccatgcgggagcg
atgtttttcggccgcttcagctccgagccggtcggcgactatttcgccgggccgaaccac
gtgctgccaaccaacggcacggccagattctcaagcggcttgagcgttgacgagtttgtg
aaaaaatcaagcgtgattgtttacagtgaaaccgcattgaaacaacatggcgacaaaatc
gccgcctttgcccgcctcgaggggctggaggcgcacgcgcgcgccattgaggtgcggctc
gagaaaggggaatga

DBGET integrated database retrieval system