KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124033Help
Entry
101124033         CDS       T02442                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04137  Mitophagy - animal
ggo04140  Autophagy - animal
ggo04141  Protein processing in endoplasmic reticulum
ggo04210  Apoptosis
ggo04215  Apoptosis - multiple species
ggo04217  Necroptosis
ggo04310  Wnt signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04530  Tight junction
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04920  Adipocytokine signaling pathway
ggo04926  Relaxin signaling pathway
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease (NAFLD)
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05142  Chagas disease (American trypanosomiasis)
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05164  Influenza A
ggo05167  Kaposi's sarcoma-associated herpesvirus infection
ggo05168  Herpes simplex infection
ggo05169  Epstein-Barr virus infection
ggo05200  Pathways in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05231  Choline metabolism in cancer
ggo05418  Fluid shear stress and atherosclerosis
Module
ggo_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101124033 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101124033 (MAPK8)
   04010 MAPK signaling pathway
    101124033 (MAPK8)
   04012 ErbB signaling pathway
    101124033 (MAPK8)
   04310 Wnt signaling pathway
    101124033 (MAPK8)
   04668 TNF signaling pathway
    101124033 (MAPK8)
   04068 FoxO signaling pathway
    101124033 (MAPK8)
   04071 Sphingolipid signaling pathway
    101124033 (MAPK8)
   04024 cAMP signaling pathway
    101124033 (MAPK8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101124033 (MAPK8)
   04137 Mitophagy - animal
    101124033 (MAPK8)
  Cell growth and death
   04210 Apoptosis
    101124033 (MAPK8)
   04215 Apoptosis - multiple species
    101124033 (MAPK8)
   04217 Necroptosis
    101124033 (MAPK8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101124033 (MAPK8)
   04530 Tight junction
    101124033 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101124033 (MAPK8)
   04621 NOD-like receptor signaling pathway
    101124033 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    101124033 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    101124033 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    101124033 (MAPK8)
   04659 Th17 cell differentiation
    101124033 (MAPK8)
   04657 IL-17 signaling pathway
    101124033 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    101124033 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    101124033 (MAPK8)
   04920 Adipocytokine signaling pathway
    101124033 (MAPK8)
   04912 GnRH signaling pathway
    101124033 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    101124033 (MAPK8)
   04917 Prolactin signaling pathway
    101124033 (MAPK8)
   04926 Relaxin signaling pathway
    101124033 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    101124033 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    101124033 (MAPK8)
   04722 Neurotrophin signaling pathway
    101124033 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101124033 (MAPK8)
  Development
   04380 Osteoclast differentiation
    101124033 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101124033 (MAPK8)
   05231 Choline metabolism in cancer
    101124033 (MAPK8)
   05210 Colorectal cancer
    101124033 (MAPK8)
   05212 Pancreatic cancer
    101124033 (MAPK8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101124033 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101124033 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101124033 (MAPK8)
   04931 Insulin resistance
    101124033 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101124033 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    101124033 (MAPK8)
   05133 Pertussis
    101124033 (MAPK8)
   05152 Tuberculosis
    101124033 (MAPK8)
   05164 Influenza A
    101124033 (MAPK8)
   05161 Hepatitis B
    101124033 (MAPK8)
   05160 Hepatitis C
    101124033 (MAPK8)
   05168 Herpes simplex infection
    101124033 (MAPK8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101124033 (MAPK8)
   05169 Epstein-Barr virus infection
    101124033 (MAPK8)
   05145 Toxoplasmosis
    101124033 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    101124033 (MAPK8)
  Drug resistance
   01522 Endocrine resistance
    101124033 (MAPK8)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101124033 (MAPK8)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101124033 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 101124033
NCBI-ProteinID: XP_004049430
Ensembl: ENSGGOG00000011771
UniProt: A0A2I2ZPX0
Position
10
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgagacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcaccagaggtcatcctcggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaagctgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccatac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system