KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124144Help
Entry
101124144         CDS       T02442                                 

Gene name
MGEA5
Definition
bifunctional protein NCOAT isoform 1
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 916 aa AA seqDB search
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKND
NQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP
GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagagtcaagcgacattggaggagcgggagagcgagctcagctccaac
cctgccgcctctgcgggggcatcgctggagccgccggcagctccggcacccggagaagac
aaccccgccggggctgggggagcggcggtggccggggctgcaggaggggctcggcggttc
ctgtgcggtgtggtggaaggattttatggaagaccttgggttatggaacagagaaaagaa
ctctttagaaggctccagaaatgggaattaaatacatacttgtatgccccaaaagatgac
tacaaacataggatgttttggcgagagatgtattcagtggaggaagctgagcaacttatg
actctcatctctgctgcacgagaatatgagatagagttcatctatgcgatctcacctgga
ttggatatcactttttctaaccccaaggaagtatccaccttgaaacgtaaattggaccag
gtttctcagtttgggtgcagatcgtttgctttgctttttgatgatatagaccataatatg
tgtgcagcagacaaagaggtattcagttcttttgctcatgcccaggtctccatcacaaat
gaaatctatcagtacctaggagagccagaaactttcctcttctgtcccacagaatactgt
ggcactttctgttatccaaatgtgtctcagtctccatatttaaggactgtgggtgaaaag
cttctacctggaattgaagtgctttggacaggtcccaaagttgtttctaaagaaattcca
gtagagtccatcgaagaggtttctaagattattaagagagctccagtaatctgggataac
attcatgctaatgattatgatcagaagagactgtttctgggcccgtacaaaggaagatcc
acagaactcatcccacggttaaaaggagtcctcactaatccaaattgtgaatttgaagcc
aactacgttgctatccacacccttgctacctggtacaaatcaaacatgaatggagtgaga
aaagatgtagtgatgactgacagtgaagatagtactgtgtccatccagataaaattagaa
aatgaaggcagtgatgaagatattgaaactgatgtactctatagtccacagatggctcta
aagctagcattaacagaatggttgcaagagtttggtgtgcctcatcaatacagcagtagg
caagttgcacacagtggagctaaagcaagtgtagttgatgggactcctttagttgcagca
ccctctttaaatgccacaaccgtagtaacaacagtttatcaggagcccattatgagccag
ggagcagccttgagtggtgagcctactactctgaccaaggaagaagaaaagaaacagcct
gatgaagaacccatggatatggtagtggaaaaacaagaagaaacggaccacaagaatgac
aatcaaatactgagtgaaattgttgaagcgaaaatggcagaggaattgaaaccaatggac
actgataaagagagcatagctgaatcaaaatccccagagatgtccatgcaagaagattgt
attagtgacattgcccccatgcaaactgatgaacagacaaacaaggagcagtttgtgcca
ggtccaaatgaaaagcctttgtacactgcggaaccagtgaccctggaggatttgcagtta
cttgctgatctattctaccttccttatgagcatggacccaaaggagcacagatgttacgg
gaatttcaatggcttcgagcaaatagtagtgttgtcagtgtcaattgcaaaggaaaagac
tctgaaaagattgaagaatggcggtcacgagcagccaagtttgaagagatgtgtggacta
gtgatgggaatgttcactcggctctccaattgtgccaacaggacaattctttatgacatg
tactcctatgtttgggatatcaagagtataatgtctatggtgaagtcttttgtacagtgg
ttagggtgtcgtagtcattcttcagcacaattcttaattggagaccaagaaccctgggcc
tttagaggtggtctagcaggagagttccagcgtttgctgccaattgatggggcaaatgat
ctcttttttcagccacctccactgactcctacctccaaagtttatactatcagaccttat
tttcctaaagatgaggcatccgtgtacaagatttgcagagaaatgtatgacgatggagtg
ggtttaccctttcaaagtcagcctgatcttattggagacaagttagtaggagggctgctt
tccctcagcctggattactgctttgtcctagaagatgaagatggcatatgtggttatgcc
ttgggcactgtagatgtgaccccctttattaaaaaatgtaaaatttcctggatccccttc
atgcaggagaagtataccaagccaaatggtgacaaggaactctctgaggctgagaaaata
atgttgagtttccatgaagaacaggaagtactgccagaaactttccttgctaatttccct
tctctgataaagatggacattcacaaaaaagtaactgacccaagtgtggccaaaagcatg
atggcttgcctcctgtcttcactgaaggctaatggctcccggggagctttctgtgaagtg
agaccagatgataaaagaattctggaattttacagcaagttaggatgttttgaaattgca
aaaatggaaggatttccaaaggatgtggttatacttggtcggagcctgtga

DBGET integrated database retrieval system