KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124245Help
Entry
101124245         CDS       T02442                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00561  Glycerolipid metabolism
ggo03320  PPAR signaling pathway
ggo04979  Cholesterol metabolism
ggo05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101124245 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101124245 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    101124245 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101124245 (LPL)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101124245 (LPL)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101124245 (LPL)
  Exosomal proteins of breast milk
   101124245 (LPL)
Glycosaminoglycan binding proteins [BR:ggo00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   101124245 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ggo00537]
 Enzymes
  101124245 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1 NAGLU
Motif
Other DBs
NCBI-GeneID: 101124245
NCBI-ProteinID: XP_004046773
Ensembl: ENSGGOG00000015435
UniProt: G3RHE2
Position
8
AA seq 475 aa AA seqDB search
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQQH
YPVAAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcgtgctgactctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcccggagta
gcagagtctgtggctacctgtcacttcaatcacagcagcaaaaccttcatggtgatccac
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaacgtcattgtggtggactggctgtcacgggctcagcagcat
tacccagtggccgcaggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgcctttctcct
gatgatgcagattttgtagacgtcttacacacattcacgagagggtcccctggtcgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctatccgcgtgattgcagagagaggacttggagacgtg
gaccagctagtgaagtgctcccacgagcgctccattcatctcttcattgactctctgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagtgaaacccataccaaccag
gcctttgagatttctctgtatggcaccgtggccgagagtgagaacatcccattcactctg
cctgaagtttccacaaataagacatactccttcctaatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaagagtgattcgtactttagctggtcagactgg
tggagcagtcccggcttcgccattcagaagatcagagtaaaagcaggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcatttgcagaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system