KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124269Help
Entry
101124269         CDS       T02442                                 

Definition
protein disulfide-isomerase A3-like isoform 1
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ggo04141]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:ggo04612]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 461 aa AA seqDB search
MCLRRPALFPGVALLLAAARLAAASDVLGLRDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKADCTANTNTCNKYGVSGYPTLKIFRAGEEAGAYDGPRT
ADGVVSHLKKQSGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNEYDDNGDGIILFRPSHLTNKLEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLILYYDVDYEKNAKGSNYWRNRVMMVAKIFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSCDGNALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPSCGHCKNLEPKYKELG
EKLSKDLNIVIAKMDATANDVPSPYEVRVFLPYTSLQPTRS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctccgccgcccagcgctgttcccaggcgtggcgctgcttctcgccgcggcccgc
ctcgcggctgcctccgacgtgctaggactcagggacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagagacttgctcctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggctgattgcactgccaacactaacacctgtaataaatatggagtcagtggatat
ccaaccctgaagatatttagagctggtgaagaagcaggtgcttatgatggacctaggact
gctgatggagttgtcagccacctgaagaagcagtcaggaccagcttcagtgcctctcagg
actgaggaagaatttaagaaattcattagtgataaagatgcctctatagtaggttttttc
gatgattcattcagtgaagctcactccgagttcctaaaagcagccagcaacttgagggat
aactaccgatttgcacatacgaatgttgagtctctggtgaacgagtatgatgataatgga
gatggtatcatcttatttcgtccttcacatctcactaacaagttggaggacaagactgtg
gcatatacagagcaaaaaatgaccagtggcaaaattaaaaagtttatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttattctttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagggtaatgatggtggcaaagatattcctggatgctgggcacaaactcaactttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggagagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcatgtgatgggaatgctctggagagattcctgcaggattactttgatggcaat
ctgaagagatacctgaagtctgaacctatcccagagagcaatgatgggcctgtgaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgaa
ttttatgccccttcgtgtggtcactgtaagaacctggagcccaagtataaagaacttggc
gagaagctcagcaaagacctgaatatcgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagagttttcctaccatatacttctctccagccaacaaga
agctaa

DBGET integrated database retrieval system