KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124269Help
Entry
101124269         CDS       T02442                                 

Definition
protein disulfide-isomerase A3-like isoform 1
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101124269
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    101124269
Enzymes [BR:ggo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101124269
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101124269
  Exosomal proteins of colorectal cancer cells
   101124269
  Exosomal proteins of bladder cancer cells
   101124269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 461 aa AA seqDB search
MCLRRPALFPGVALLLAAARLAAASDVLGLRDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKADCTANTNTCNKYGVSGYPTLKIFRAGEEAGAYDGPRT
ADGVVSHLKKQSGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNEYDDNGDGIILFRPSHLTNKLEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLILYYDVDYEKNAKGSNYWRNRVMMVAKIFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSCDGNALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPSCGHCKNLEPKYKELG
EKLSKDLNIVIAKMDATANDVPSPYEVRVFLPYTSLQPTRS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctccgccgcccagcgctgttcccaggcgtggcgctgcttctcgccgcggcccgc
ctcgcggctgcctccgacgtgctaggactcagggacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagagacttgctcctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggctgattgcactgccaacactaacacctgtaataaatatggagtcagtggatat
ccaaccctgaagatatttagagctggtgaagaagcaggtgcttatgatggacctaggact
gctgatggagttgtcagccacctgaagaagcagtcaggaccagcttcagtgcctctcagg
actgaggaagaatttaagaaattcattagtgataaagatgcctctatagtaggttttttc
gatgattcattcagtgaagctcactccgagttcctaaaagcagccagcaacttgagggat
aactaccgatttgcacatacgaatgttgagtctctggtgaacgagtatgatgataatgga
gatggtatcatcttatttcgtccttcacatctcactaacaagttggaggacaagactgtg
gcatatacagagcaaaaaatgaccagtggcaaaattaaaaagtttatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttattctttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagggtaatgatggtggcaaagatattcctggatgctgggcacaaactcaactttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggagagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcatgtgatgggaatgctctggagagattcctgcaggattactttgatggcaat
ctgaagagatacctgaagtctgaacctatcccagagagcaatgatgggcctgtgaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgaa
ttttatgccccttcgtgtggtcactgtaagaacctggagcccaagtataaagaacttggc
gagaagctcagcaaagacctgaatatcgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagagttttcctaccatatacttctctccagccaacaaga
agctaa

DBGET integrated database retrieval system