KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124513Help
Entry
101124513         CDS       T02442                                 

Gene name
AGL
Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101124513 (AGL)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     101124513 (AGL)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     101124513 (AGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1365 aa AA seqDB search
MGHSKQIRILLLNEMEKLEKTLFRLEQGYELQFRLGPTLQGKAVTVYTNYPFPGETFNRE
KFRSLDWENPTEREDDSDKYCKLNLQQSGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLE
LNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVN
SPHLKPAWVLDRALWRFSCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWE
FFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPH
EYFTFPFEEIDFSMEESMIHLPNKACFLMAHNGWVMGDDPLRNFAEPGSEVYLRRELICW
GDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYMLDAARNLQ
PNLYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGEPVGSFVQP
CLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACCASGSTRGYDELVPHQ
FLGKIEEVVLEARTIERNMKPYRKDENSINGTPDITVEIREHIQLNESKIVKQAGVATKG
PNEYIQEIEFENLSPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPI
LKIPFASIASRLTLAELNQILYRCESEEKEDGGGCYDIPNWSALKYAGLQGLMSVLAEIR
PKNDLGHPFCNNLRSGDWMIDYVSNRLISRSGTIAEVGKWLQAMFFYLKQIPRYLIPCYF
DAILIGAYTTLLDTAWKQMSSFVQNGSTFVKHLSLGSVQLCGVGKFPSLPILSPALMDVP
YRLNEITKEKEQCCVSLAAGLPHFSSGIFRCWGRDTFIALRGILLITGRYVEARNIILAF
AGTLRHGLIPNLLGEGIYARYNCRDAVWWWLQCIQDYCKMVPNGVDILKCPVSRMYPTDD
SAPLPAGTLDQPLFEVIQEAMQKHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGF
VYGGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVRWLLELSKKNIFP
YHEVTVKRHGKAIKVSYDEWNRKIQDNFEKLFHVSEDPSDLNEKHPNLVHKRGIYKDSYG
ASSPWCDYQLRPNFTIAMVVAPELFTTEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGI
YDNALDNDNYNLAKGFNYHQGPEWLWPIGYFLRAKLYFSRLMGPETTAKTIVLVKNVLSR
HYVHLERSPWKGLPELTNENAQYCPFSCETQAWSIATILETLYDL
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atgggacacagtaaacagattcgaattttacttctgaacgaaatggagaaactggaaaag
accctcttcagacttgaacaagggtatgaactacagttccgattaggcccaactttacag
ggaaaagcagttaccgtgtatacaaattacccatttcctggagaaacatttaatagagaa
aaattccgttctctggattgggaaaatccaacagaaagagaagatgattctgataaatac
tgtaaacttaatctgcaacaatctggttcatttcagtattatttccttcaaggaaatgag
aaaagtggtggaggttacatagttgtggaccccattttacgtgttggtgctgataatcat
gtgctacccttggactgtgttactcttcagacatttttagctaagtgtttgggacctttt
gatgaatgggaaagcagacttagggttgcaaaagaatcaggctacaacatgattcatttt
accccattgcagactcttggactatctaggtcatgctactcccttgccaatcagttagaa
ttaaatcctgacttttcaagacctaatagaaagtatacctggaatgatgttggacagcta
gtggaaaaattaaaaaaggaatggaatgttatttgtattactgatgttgtctacaatcat
actgctgctaatagtaaatggatccaggaacatccagaatgtgcctataatcttgtgaat
tctccacacttaaaacctgcctgggtcttagacagagcactttggcgtttctcctgtgat
gttgcagaagggaaatacaaagaaaagggaatacctgctttgattgaaaatgatcaccat
atgaattccatccgaaaaataatttgggaggatatttttccaaagcttaaactctgggaa
tttttccaagtagatgtcaacaaagcggttgagcaatttagaagacttcttacacaagaa
aataggcgagtaaccaagtctgatccaaaccaacatcttacgattattcaagatcctgaa
tacagacggtttggctgtactgtagatatgaacattgcactaacgactttcataccacat
gagtattttactttcccatttgaagagatagacttctccatggaagaatctatgattcat
ctcccaaataaagcttgttttctgatggcacacaatggatgggtaatgggagatgatcct
cttcgaaactttgctgaaccgggttcagaagtttacctaaggagagaacttatttgctgg
ggagacagtgttaaattacgctatgggaataaaccagaggactgtccttatctctgggca
cacatgaaaaaatacactgaaataactgcaacttatttccagggagtacgtcttgataac
tgccactcaacacctcttcacgtagctgagtacatgttggatgctgctaggaatttgcaa
cccaatttatatgtagtagctgaactgttcacaggaagtgaagatctggacaatgtcttt
gttactagactgggcattagttccttaataagagaggcaatgagtgcatataatagtcat
gaagagggcagattagtttaccgatatggaggagaacctgttggatcctttgttcagccc
tgtttgaggcctttaatgccagctattgcacatgccctgtttatggatattacgcatgat
aatgagtgtcctattgtgcatagatcagcgtatgatgctcttccaagtactacaattgtc
tctatggcgtgttgtgctagtggaagtacaagaggctatgatgaattagtgcctcatcag
ttcctaggcaaaattgaagaagtagttcttgaagctagaactattgagagaaacatgaaa
ccttataggaaggatgagaattcaatcaatggaacgccagatatcacagtagaaattaga
gaacatattcagcttaatgaaagtaaaattgttaaacaagctggagttgccacaaaaggg
cccaatgaatatattcaagaaatagaatttgaaaacttgtctccaggaagtgttattata
ttcagagttagtcttgatccacatgcacaagtcgctgttggaattcttcgaaatcatctg
acacaattcagtcctcactttaaatctggcagcctagctgttgacaatgcagatcctata
ttaaaaattccttttgcttctattgcctccagattaactttggctgagctaaatcagatc
ctttaccgatgtgaatcagaagaaaaggaagatggtggagggtgctatgacataccaaac
tggtcagcccttaaatatgcaggtcttcaaggtttaatgtctgtattggcagaaataaga
ccaaagaatgacttggggcatcctttttgtaataatttgagatctggagattggatgatt
gactatgtcagtaaccggcttatttcacgatcaggaactattgctgaagttggtaaatgg
ttgcaggctatgttcttctacctgaagcagatcccacgttaccttatcccatgttacttt
gatgctatattaattggtgcatataccactcttctggatacagcatggaagcagatgtca
agctttgttcagaatggttcaacctttgtgaaacacctttcattgggttcagttcaactg
tgtggagtaggaaaattcccttccctgccaattctttcacctgccctaatggatgtacct
tataggttaaatgagatcacaaaagaaaaggagcaatgttgtgtttctctagctgcaggc
ttacctcatttttcttctggtattttccgctgctggggaagggatacttttattgcactt
agaggtatactgctgattactggacgctatgtagaagccaggaatattattttagcattt
gcgggtaccctgaggcatggtctcattcctaatctactgggtgaaggaatttatgccaga
tacaattgtcgggatgctgtgtggtggtggctgcagtgtatccaggattactgtaaaatg
gttccaaatggtgtagacattctcaagtgcccagtttccagaatgtatcctacagatgat
tctgctcctttgcctgctggcacactggatcagccattgtttgaagtcatacaggaagca
atgcaaaaacacatgcagggcatacagttccgagaaaggaatgctggtccccagatagat
cgaaacatgaaggacgaaggttttaatataactgcaggagttgatgaagaaacaggattt
gtttatggaggaaatcgtttcaattgtggcacatggatggataaaatgggagaaagtgac
agagctagaaacagaggaatcccagccacaccaagagatgggtctgctgtggaaattgtg
ggcctgagtaaatctgctgttcgctggttgctggaattatccaaaaaaaatattttccct
tatcatgaagtcacagtaaaaagacatggaaaggctataaaggtctcatatgatgagtgg
aacagaaaaatacaagacaactttgaaaagctatttcatgtttcagaagacccttcagat
ttaaatgaaaagcatccaaatctggttcacaaacgtggcatatacaaagatagttatgga
gcgtcaagtccttggtgtgactatcagctcaggcctaattttaccatagcaatggttgtg
gcccctgagctctttactacagaaaaagcatggaaagctttggagattgcagaaaaaaaa
ttgcttggtccccttggcatgaaaactttagatccagatgatatggtttactgtggaatt
tatgacaatgcattagacaatgacaactacaatcttgctaaaggtttcaattatcaccaa
ggacctgagtggctgtggcctattgggtattttcttcgtgcaaaattatatttttccaga
ttgatgggcccggagactactgcaaagactatagttttggttaaaaatgttctttcccga
cattatgttcatcttgagagatccccttggaaaggacttccagaactgaccaatgagaat
gcccagtactgtcctttcagctgtgaaacacaagcctggtcaattgctactattcttgag
acactttatgatttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system