KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124527Help
Entry
101124527         CDS       T02442                                 

Gene name
RBKS
Definition
ribokinase isoform 1
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101124527 (RBKS)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101124527 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2A
AA seq 322 aa AA seqDB search
MAASGEPQRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCV
QAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNI
IVIVAGANLLLNTEDLRAAANVINRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAP
AIADLDPRFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEG
CVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEDMLKRSNFIAAV
SVQAAGTQSSYPYKKDLPLTLF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctggggaaccccagaggcagtggcaagaggaggtggcggcggtggtagtg
gtgggctcctgcatgaccgacctggtcagccttacttctcgtttgccaaaaactggagaa
accatccatggacataagttttttattggctttggagggaaaggtgccaaccagtgtgtc
caagctgctcggcttggagcaatgacgtccatggtgtgtaaggttggcaaagattctttt
ggcaacgattacatagaaaacttaaaacagaatgatatttctacagaatttacatatcag
actaaagatgctgctacaggaactgcttctataattgtcaataatgaaggccagaatatc
attgtcatagtggctggagcaaatttacttttgaatacggaggatctgagggcagcagcc
aatgtcattaacagagctaaagtcatggtctgccagctcgaaataactccagcaacttct
ttggaagccctaacaatggcccgcaggagtggagtgaaaaccttgttcaatccagcccct
gccattgctgacctggatccccggttctacaccctctcagatgtgttctgctgcaatgaa
agtgaggctgagattttaactggcctcacggtgggcagcgctgcagatgctggggaggct
gcattagtgctcttgaaaaggggctgccaggtggtaatcattaccttaggggctgaagga
tgtgtggtgctgtcacagacagaacctgagccaaagcacattcccacagagaaagtcaag
gctgtggataccacgggtgctggtgacagctttgtgggagctctggccttctacctggct
tactatccaaatctgtccttggaagacatgctcaagagatccaatttcattgcagcagtc
agtgtccaggctgcaggaacacagtcatcttatccttacaaaaaagaccttccgcttact
ctgttttga

DBGET integrated database retrieval system