KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124835Help
Entry
101124835         CDS       T02442                                 

Gene name
DHFR
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101124835 (DHFR)
   00670 One carbon pool by folate
    101124835 (DHFR)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     101124835 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 262 aa AA seqDB search
MAARRQGPAGSASPRPQFPGVCGREHAATLRAPGRGGGASSAQIGTRGRGGHNFAPNLTA
RSAVTSGLGGPPAAVMVGSLNCIVAVSQNMGIGKNGVLPWPPLRNEFRYFQRMTTTSSVE
GKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPE
LANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPG
VLSDVQEEKGIKYKFEVYEKND
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccggcggcagggcccggcggggagcgcgagcccgcggccacagttcccaggc
gtctgcgggcgcgagcacgctgcgaccctgcgtgcgccggggcgggggggcggggcctcg
tctgcacaaatagggacgagggggcggggcggccacaatttcgcgccaaacttgaccgcg
cgttctgctgtaacaagcgggctcggaggtcctcccgctgctgtcatggttggttcgcta
aactgcatcgtcgctgtgtcccagaacatgggcatcggcaagaacggggtcctgccctgg
ccaccgctcaggaatgaattcagatatttccagagaatgaccacaacctcttcagtagaa
ggtaaacagaatctggtgattatgggtaagaagacctggttctccattcctgagaagaat
cgacctttaaagggtagaattaatttagttctcagcagagaactcaaggaacctccacaa
ggagctcattttctttccagaagtctagatgatgccttaaaacttactgaacaaccagaa
ttagcaaataaagtagacatggtctggatagttggtggcagttctgtttataaggaagcc
atgaatcacccaggccatcttaaactatttgtgacaaggatcatgcaagactttgaaagt
gacacgttttttccagaaattgatttggagaaatataaacttctgccagaatacccaggt
gttctctctgatgtccaggaggagaaaggcattaagtacaaatttgaagtatatgagaag
aatgattaa

DBGET integrated database retrieval system