KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125007Help
Entry
101125007         CDS       T02442                                 

Gene name
PLCE1
Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101125007 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101125007 (PLCE1)
   04015 Rap1 signaling pathway
    101125007 (PLCE1)
   04020 Calcium signaling pathway
    101125007 (PLCE1)
   04070 Phosphatidylinositol signaling system
    101125007 (PLCE1)
   04024 cAMP signaling pathway
    101125007 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101125007 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101125007 (PLCE1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101125007 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 2247 aa AA seqDB search
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISRLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQR
QFYEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELNRPSMGISPLGNQSAIIETGRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPGGEEKQKKNYVAYTCKLMELAK
NCDNKNEQLQCDHCDTLNDKYFCFEGSCKKVDMVYSSDSFCRKDFTDSQAAKTFLSHFED
FPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTAWS
YIDQKRNGALLPCGRVMEPPSTVEIRQDGSRRLSEAQWYPIYNAVRREETENTVGSLLHF
LTKLPASKTAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSG
LLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQ
EQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFN
EVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQF
MDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASG
LMKLCPQYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLE
TDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHG
TELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPA
SSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKL
GSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQW
LRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLGIS
TTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEANAIANPPN
PLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKG
FQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIDE
NTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIF
GVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFAS
KNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWD
GDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFK
TVFGEKLVTKFLFETDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASM
QAQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEE
IPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGLST
LNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPT
TSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPL
MFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERD
LDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNE
QFLFRVHFEDLVFLRFAVVENNSSVVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLF
INSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLL
QQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEDIMQILSSWFPEEG
YVGRIVLKTQQETLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQ
ECVFQAQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQL
LTSESIQTKEEKPMGGLSSSDTMDYRQ
NT seq 6744 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatgacagcttctgttctcatacctgtgactcagagaaaagtggtt
tctgcccagtcggctgcagatgaaagtagtgaaaaggtctcagacatcaatatttcaaaa
gcacatactgtcagacgaagtggggagacttctcataccatctcacgactgaacaaactt
aaagaagaaccttctggaagcaacttgccaaagattctctcaatagcaagggagaaaata
gtgagtgatgagaacagtaatgaaaaatgttgggagaaaatcatgccagattctgcgaaa
aaccttaacattaactgcaacaacatattgagaaaccatcagcatggccttcctcagaga
cagttttatgaaatgtacaactctgttgctgaggaagacttgtgtttagaaactggaatt
ccttctccactggaaagaaaggtgttccctggaattcaactggaactaaacagaccttcc
atgggcattagtcctttaggaaatcagtcagcgatcatagagacaggcagagcacaccct
gacagcagaagggcagtatttcattttcattatgaagttgacagaagaatgtcagacact
ttctgtaccctatcagaaaacttaattttagacgattgtggaaattgtgtacctgggggt
gaggagaagcaaaagaaaaactatgtggcatatacctgtaaactgatggaattggccaaa
aattgtgataataagaatgagcagctgcagtgtgatcattgtgacaccttgaatgataaa
tacttttgctttgaaggctcttgcaagaaggttgacatggtatattcaagtgatagcttt
tgtaggaaagactttactgacagtcaagctgccaagacctttttgagccattttgaggac
ttccctgataattgtgatgatgtagaagaagatgcttttaaaagcaaaaaggagcgatcc
actttgttagtcaggagattctgtaaaaatgacagagaagttaagaaatctgtgtatact
ggaacaagagcaattgtgagaactctgccttctggccacattgggctgactgcatggagt
tacatagatcagaagagaaatggtgccttactgccttgtgggagagtaatggaacccccg
tcaacagtggagataaggcaagatgggagccgacgtctgtcagaagcccagtggtatcct
atctacaatgcagtgagaagagaagaaacagaaaatacagttggatctctactccatttc
ctcaccaagctcccagcctccaagacagcccatggaaggataagcgttggtccatgctta
aagcaatgtgtccgagacactgtatgtgagtatcgcgccaccctccaaaggacttcaata
tcgcagtacatcaccggttctctcctagaagcaaccacgtctttgggagcaagaagtggc
cttctcagtacttttggaggatccactggacgaatgatgctgaaagaacgccagccaggc
ccctctgtggccaattccaatgccctcccttcaagttcagctgggatcagcaaggagctg
atcgatctgcagcctctcatccagttcccagaggaagtcgccagcatcctgatggagcaa
gagcagactatttaccgcagggtcttgccagttgactacctttgcttcttaacacgggac
ttgggcactcctgaatgccagagctccttgccctgcctcaaagcatccatctcagcgtca
attcttaccactcagaatggagagcacaatgcccttgaagatctggtgatgaggtttaat
gaggtgagctcctgggtgacatggctgatcctcacggcaggctccatggaggagaagcga
gaagtcttttcatatttggtgcatgtggccaaatgctgctggaacatgggcaactacaat
gctgtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatgtggcagttc
atggaccagtctgatattgagaccatgaggagcctgaaggatgctatggcccagcatgag
tcctcttgtgagtacagaaaggtggtgacacgtgccctgcacatccctggctgtaaggtg
gttccattctgtggggtgtttctgaaggagctctgtgaagtgcttgacggcgcctctggc
ctcatgaagctttgcccgcagtacaattcccaagaagaaactttagagtttgtagcagat
tacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaagaattcggag
aaggagtccactgtcaacagcatctttcaggtcatccggagctgcaatcgaagtctggag
acagacgaggaggacagccccagtgaaggaaacagctccaggaaaagctccttgaaggat
aaaagccgatggcagtttataattggagatttgttggattcagacaatgacatctttgag
caatccaaagaatacgactctcatggttcagaggactcacagaaggccttcgaccatggg
acggagctcatcccttggtacgtgctgtccatccaagccgatgtgcaccagttcctgctg
cagggggccacagtcatccactacgaccaggacacacacctctctgcccgctgcttcctc
cagcttcagcccgacaatagcaccttgacctgggtaaagcccacaactgcctccccagcc
agcagtaaagcaaaacttggtgtacttaataacacagctgagcctggaaaattcccacta
ctgggtaatgctggattaagtagcctgacggaaggggtcttggatctttttgcagtgaag
gctgtatacatgggccaccctggcattgatatacacactgtgtgtgttcagaacaaactg
ggtagcatgttcctgtcagagactggtgtgacattgctctatgggcttcagaccacagac
aacagattattgcacttcgtggcaccaaagcacacagctaaaatgctcttcagtggatta
ttggaactcactagagctgtgagaaagatgaggaaattccctgaccaaagacagcagtgg
ctgcggaaacagtacgtcagcctttatcaggaggatggacggtatgaaggcccaactttg
gctcacgctgtggagttgtttggtggcagacggtggagtgctcgaaaccccagccctgga
acatcagcaaagaatgctgagaagcccaatatgcagagaaacaataccctgggcataagc
actaccaagaaaaagaagaaaatcctcatgaggggtgagagtggagaggtaactgacgat
gagatggcaacccgaaaggccaagatgcacaaagagtgtcgaagccggagtggttctgat
cctcaagacattaatgaacaagaagaatcagaggcgaatgccatcgctaaccctccaaac
cccctcccttccagaagagcccactctttgaccacagctgggtcccccaacttggctgcc
gggacgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaacaagagc
ccatccagtgcttggagcagtagtagctggcacgggcggatcaaaggcggcatgaaggga
tttcagagcttcatggtttcagatagcaacatgagttttgttgaatttgttgagctgttc
aaatcgttcagtgtcaggagccgcaaggacctgaaggatctgtttgatgtctatgcagtg
ccctgcaaccgatctggctccgagtcagccccactctacaccaacctgacaattgatgaa
aacaccagcgatcttcagcctgacctagatctgttgaccagaaatgtctcggatttgggg
ttgttcattaagagtaaacagcagctatcggacaaccagaggcagatatctgatgccatt
gctgctgcaagcattgtgacaaatggcactgggattgagagcacatctctgggcattttt
ggggtgggcatacttcagctcaatgatttcctcgtgaattgccaaggagaacactgcact
tatgatgaaatcctcagcatcatccagaagttcgagcctagcatcagtatgtgtcatcag
ggactaatgtcatttgaagggtttgcaaggtttctgatggataaagaaaattttgcctca
aaaaatgatgagtcacaggagaacattaaagaactgcagctacccctttcatactattac
atcgaatcttcgcacaatacctacctcacgggccatcagctcaaaggcgaatcctcggta
gaactctacagccaggtccttttgcaaggctgtcgaagtgtagaattggactgctgggac
ggagacgatggcatgcccatcatttatcatggacatacgctgacaaccaagatccccttc
aaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctgccaatcatc
atatcaattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaattttcaag
actgtgtttggagaaaagctggtgactaaattcttatttgagactgatttctcagatgat
ccaatgcttccttcacctgaccaactcagaaggaaagttcttcttaaaaacaagaagcta
aaagcccatcagacgccagtggatatcttaaagcaaaaggctcatcagttagcatctatg
caagcgcaggcttataatggtgggaatgccaaccccccacctgccaataatgaggaagaa
gaagatgaggaggacgaatatgattatgactatgaatccctttctgatgacaacattctg
gaagacagacctgaaaataaatcatgtaatgacaagcttcagtttgaatataatgaagaa
atcccaaagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtttatgat
atggaactgggagaagaattttatcttgatcagaataaaaaggaaagcagacagattgca
ccagagctttctgaccttgtaatctattgtcaagcagtaaaatttccaggactgtcaact
ctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatttttggc
aacaatccgggcagaatgagcccaggggagacagcatcatttaacaaaacatctggaaaa
agttcctgtgaaggcattcgacagacctgggaggaatcttcttcccctctcaacccaacc
acgtccctcagtgctatcattagaactcccaaatgttatcatatctcgtcgctgaatgaa
aatgccgccaaacgtctgtgtcgcaggtattctcagaaactgatccagcacaccgcctgt
cagctgctgagaacttaccctgctgccacccgcatcgactcttccaacccgaaccccctc
atgttctggctccatgggatacagctcgtggcactcaactaccagaccgatgatctccct
ttacatttaaatgctgcaatgtttgaggcaaatggtggttgtggttatgttttgaaacct
ccagttctgtgggacaagaactgccccatgtatcagaagttttctccactagaaagagat
ctggacagcatggatcctgcagtctattctttaactattgtctctggtcagaatgtgtgc
cccagtaatagcatgggaagcccatgcattgaagtcgacgtcctgggcatgcctctggac
agctgccatttccgcacaaagcccatccatcgaaacaccctgaaccccatgtggaacgag
cagtttctgttccgcgttcacttcgaagatcttgtatttcttcgttttgcagttgtggaa
aacaatagttcagtggtaactgctcagagaatcattccactgaaagctttaaaacgagga
tatcgacatcttcagctgcgaaaccttcacaatgaagtcttggagatttctagtttattc
attaacagcagaaggatggaagaaaattcctctggcaataccatgtcagcctcttcgatg
tttaatacagaagaaagaaaatgtttgcagactcacagagtcacggtgcatggggtccca
gggccagagccctttaccgttttcactattaatggaggcaccaaggcaaagcagcttctg
cagcaaattctgacaaatgaacaagacatcaaacctgttaccacagactattttttgatg
gaagaaaaatattttatatctaaagaaaagaatgaatgtaggaaacaaccattccagaga
gccattggtccagaagaggacatcatgcaaattttaagcagctggtttccagaagaggga
tacgtgggcaggattgtcttaaaaacccagcaggaaaccttatgcaaagccaaatattcc
tacagcatcctgagcaaccccaatccaagcgactatgtgcttttggaagaggtggtgaaa
gacactaccaacaagaagaccaccacaccaaagtcctctcagcgggtccttctggatcag
gagtgtgtgtttcaagcccaaagcaagtggaaaggtgcaggaaaattcatccttaagcta
aaggagcaggtgcaggcatctcgagaagataaaaagaaaggcatttctttcgcaagtgaa
ctcaagaagctcaccaagtcaactaaacagccccgaggacttacatcaccttctcagctc
ttgacctcagaaagtatccaaaccaaggaggagaaacctatgggtggcttgtcctccagt
gacacaatggattaccgacagtga

DBGET integrated database retrieval system