KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125016Help
Entry
101125016         CDS       T02442                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101125016 (UCHL5)
Peptidases [BR:ggo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101125016 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 520 aa AA seqDB search
MPTSRSGPGFGKGPPSGMVRPGLARMSLPRCWFHYPGWAGAEAGRGRAIVSRRLPSLNPW
DAGERHGGLVRICASLGPHKRLPAGLPQCPHLYPAADPLDPQRRQEKSCAALGNDKRRQP
DGQRQRQQQQQPHCRRGFQVPALPNPLRVLQGLGRVSMSLGWLERPPALSCAAGDGARRL
SGSRRGDVWLTSSAAGLLRSVAGGSWCRGHLRARGGSGRCVARAMTGNAGEWCLMESDPG
VFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
IFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVI
RQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDW
ISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSM
LSAIQSEVAKNQMLIEEEVQKLKRYKAKEKQNAKKAQETK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccgacaagcaggagcggtcccggcttcggaaagggcccaccctcaggaatggtccgg
ccgggcctagcgaggatgtccctaccgcgatgctggttccattacccagggtgggcaggc
gcggaagcgggacggggaagagcgatagtttcgcggcgtttgcccagcctcaacccctgg
gatgcgggtgagagacatggaggactggtcagaatttgcgcgtccctggggccgcacaaa
aggctcccagccggcctcccgcaatgtcctcacctgtacccggcagccgaccccctggac
ccgcagcgccgccaggagaagtcctgcgcagcgctgggaaacgacaagagaaggcagcct
gacgggcagcgacagcgacagcaacagcaacagccccactgccgccggggcttccaggtc
ccagcccttccgaatccgctacgggtgctgcaaggcctgggaagagtttcgatgtctcta
gggtggctagagcgtcctcccgcgctcagttgcgctgcaggtgacggcgcccggaggctg
tcgggaagtaggcggggtgacgtgtggttgacgagctcggcggcgggtttgctgagatct
gtggccggcggcagctggtgcagggggcacctgagagcgagaggtggatcggggcggtgt
gtggccagggccatgacgggcaatgccggggagtggtgcctcatggaaagcgaccccggg
gtcttcaccgagctcattaaaggattcggttgccgaggagcccaagtagaagaaatatgg
agtttagagcctgagaattttgaaaaattaaagccagttcatgggttaatttttcttttc
aagtggcagccaggagaagaaccagcaggctctgtggttcaggactcccgacttgacacg
atattttttgctaagcaggtaattaataatgcttgtgctactcaagccatagtgagtgtg
ttactgaactgtacccaccaggatgtccatttaggcgagacattatcagagtttaaagaa
ttttcacaaagttttgatgcagctatgaaaggcttggcactgagcaattcagatgtgatt
cgacaagtacacaacagtttcgccagacagcaaatgtttgaatttgatacgaagacatca
gcaaaagaagaagatgcttttcactttgtcagttatgttcctgttaatgggagactgtat
gaattagatggattaagagaaggaccgattgatttaggtgcatgcaatcaagatgattgg
atcagtgcagtaaggcctgtcatagaaaaaaggatacaaaagtacagtgaaggtgaaatt
cgatttaatttaatggccattgtgtctgacagaaaaatgatatatgagcagaagatagca
gagttacaaagacaacttgcagaggaggaacccatggatacagatcaaggtaatagtatg
ttaagtgctattcagtcagaagttgccaaaaatcagatgcttattgaagaagaagtacag
aaattaaaaagatacaaggcaaaagaaaaacagaacgcaaagaaagctcaggaaaccaaa
tga

DBGET integrated database retrieval system